DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and adgre14

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_021330419.1 Gene:adgre14 / 108182849 ZFINID:ZDB-GENE-131120-49 Length:505 Species:Danio rerio


Alignment Length:294 Identity:55/294 - (18%)
Similarity:103/294 - (35%) Gaps:92/294 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 FPKSMWIIRHRCTSHISPGSLEILIITMICFVLTIAVYLYI---KKLRNVTGKCIVCCIVS---- 260
            |.:..|          |||...:..|. ||..|.:|..|::   :.|..:..:.::|.::|    
Zfish   239 FTRCQW----------SPGVNNVARIN-ICISLLLAHLLFLLTQQFLSLIRRQKVLCMLISGLLH 292

  Fly   261 ---------RFIQCLIMILDHLNLLNGICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVD 316
                     .||:.:::.:...||       :..||....:..|..|.||.|....|:.|:    
Zfish   293 FLFLSGFVWMFIEAVLLFICVKNL-------SQISSQMKNVLRNKLLCVIGYAVALVVVSI---- 346

  Fly   317 PNYRFLRYNAFVWSTAAIMTGSIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPS 381
                         |.|.:..|                     .|..:|.::.....:|.:: ||.
Zfish   347 -------------SAAVVPNG---------------------YGSEKCWIQMHKGFIWSFL-GPV 376

  Fly   382 LALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRIN---CINFDSQTYLQFLRLSIVMGLTWIF 443
            ..:...||.:|.....   .:|....|. |.:..::|   .:.|  :|..||    :|:|.:||.
Zfish   377 TIIIALNVILFISIGF---SLKSAFKKL-NADVSQLNQTKIVMF--KTLAQF----VVLGCSWIL 431

  Fly   444 NVIPYSARLHIFWEWVGIISEYFHSAFGIVLFVL 477
            .....|:::      :.|:....:|..|..:|::
Zfish   432 GFFTNSSKV------LEILFLILNSQQGTFIFLI 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 2/10 (20%)
adgre14XP_021330419.1 GPS 167..205 CDD:197639
7tm_GPCRs 214..476 CDD:333717 55/294 (19%)
TM helix 1 217..241 CDD:320095 1/1 (100%)
TM helix 2 250..271 CDD:320095 6/21 (29%)
TM helix 3 285..307 CDD:320095 3/21 (14%)
TM helix 4 331..347 CDD:320095 6/32 (19%)
TM helix 5 365..388 CDD:320095 5/23 (22%)
TM helix 6 412..435 CDD:320095 8/28 (29%)
TM helix 7 439..464 CDD:320095 4/27 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.