DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and adgrg2a

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_005162818.2 Gene:adgrg2a / 101882832 ZFINID:ZDB-GENE-140106-206 Length:2289 Species:Danio rerio


Alignment Length:496 Identity:99/496 - (19%)
Similarity:180/496 - (36%) Gaps:143/496 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IEIPASLTG-----------------YYEFRQFGDGSITPIEKHLRACVCSVRPCIRICCPAKNF 97
            :.:|||||.                 |.:...|.|.::.  :|.|.:.:..            :.
Zfish  1790 VTLPASLTENLSPEEQKMASRVQFTFYQKSTFFQDANLN--QKKLNSYILG------------SS 1840

  Fly    98 LANGKCDDGLKEELARFKPYIYFTYMDLQARVPLTDMAIIRDEFFDCDEMIYISDFNYFLEEVSI 162
            :||        ..:...:..|.||.|:.|   |:....:....|:|.|:                
Zfish  1841 VAN--------LSIRNLRENIEFTLMNKQ---PVAGNYVAVCVFWDFDK---------------- 1878

  Fly   163 QIFNKCGLIVWFQDGKFWVTVDLFMEKQDYCLYRHNFDSDFPKSMWIIRHRCTSHISPGSLEILI 227
               |: ||..|.:||  ...::...|.:..|...|.  :.|...|.|.:...|..     ::..|
Zfish  1879 ---NE-GLGGWNRDG--CSVMNSSTENETICSCSHL--TSFAVLMDISQQGVTDR-----MQATI 1930

  Fly   228 ITMICFV----------LTIAVYLYIKKL-RNVTGKCIV-CCIVSRFIQCLIMILDHLNLLN--- 277
            :|.|.::          :|:..||...|: |::..|.:: .|....|:. |:.:||....|.   
Zfish  1931 LTFISYIGCGVSAIFLSVTLLTYLSFDKIRRDIPSKILIHLCFALLFLN-LVFLLDSWLALYTDA 1994

  Fly   278 -GICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSL-NRVDPNYRFLRYNAFVWSTAAIMTGSIY 340
             |:|....:..|:|.:.|..|:.:.:.|.:..:..: |.....| .|:::...|.....:...:.
Zfish  1995 VGLCISTAFFLHYFLLVSFTWMGLEALHMYLAIVKVFNNFMSRY-MLKFSLIGWGVPLAVVIIVI 2058

  Fly   341 IVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWI------YISGPSLALSTF--NVAMFALTAI 397
            .:|        |.|: .|:.:.:.|........|:      |::..:.....|  |:|||.:..:
Zfish  2059 AIN--------KDNY-GLISYGKFSDGTTDDFCWLKNSTAFYVAVVAYFCIIFVLNLAMFVVVMV 2114

  Fly   398 YIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLR----LSIVMGLTWIFNVIPYSARLHIFWEW 458
            ::|::|            |.|..|...::.:|.||    |:.::||||.|          .|:.|
Zfish  2115 HLRRIK------------RRNPHNNQYRSGVQDLRSIAGLTFLLGLTWGF----------AFFAW 2157

  Fly   459 --VGIISEYFHSAF----GIVLFVL-LVLK---RSTWTLMM 489
              |.:...|..|.|    |..:||. ..||   |..|.:.:
Zfish  2158 GPVNLAFTYLFSIFNCLQGFFIFVFHCALKENVRKEWRIYL 2198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 33/180 (18%)
adgrg2aXP_005162818.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.