DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and adgrf11

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_005160858.1 Gene:adgrf11 / 100537132 ZFINID:ZDB-GENE-121214-165 Length:691 Species:Danio rerio


Alignment Length:323 Identity:65/323 - (20%)
Similarity:121/323 - (37%) Gaps:75/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 EKQD--YCLYRHNFDSDFPKSMWIIRHRCTSHISPGSLEILIITM-ICFVLTIAVYLYIKK---- 245
            ||.|  .|...|........|.:.|..:...:|:...|.|.:::: |..::...|:..:.|    
Zfish   345 EKIDKITCECNHTTSFSLLMSPFFIDDKALDYITYTGLGISVLSLVISLIIGAIVWTTVTKSNSA 409

  Fly   246 -LRNVTGKCIVCCIVSRFIQCLIMILDHLNLLNGICSPAG------YSSHFFRMASNLWLSV--- 300
             ||:|   |:|...||..:..:..|:....:..|..:|.|      :|.|.|.:|...|:.:   
Zfish   410 YLRHV---CLVNTNVSLLVADVCFIIGASIVQPGQLAPVGPCTAVAFSMHLFFLAFFFWMLISAM 471

  Fly   301 -ISYHTWKVLTSLNRVD--PNYRFLRYNA------FVWSTAAIMTGSIYIVNQIWEN-DPSKWNW 355
             :.|.|..|.:.::|..  ....||.|.|      ..:...|.....|...:..|.| |.:|   
Zfish   472 LLLYMTTMVYSQMSRAKMMAIAFFLGYGAPLLIVVITYGLTAREGKYILEADVCWLNFDETK--- 533

  Fly   356 LPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIY----IRKVKGGINKFTN--EEE 414
                            ::.|::|..| :.:..|| :..:..:|    :||.:   ||.||  ...
Zfish   534 ----------------ALQIFVSLAS-SFTAVNV-LIIIVVLYKMLIVRKQQ---NKETNILPTV 577

  Fly   415 GRINCINFDSQTYLQFLRLSIVMGLTW---IFNVIPYSARLHIFWEWVGIISEYFHSAFGIVL 474
            .|:            .|.:|.:.|:||   |..::.....:|:.:..:..:...|:...|:::
Zfish   578 TRV------------VLIVSPLFGVTWGLGIGTMLSPDYGIHLVFTILNSLQGIFNLVSGLLV 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 7/27 (26%)
adgrf11XP_005160858.1 GAIN 143..>227 CDD:293098
GPS 318..363 CDD:280071 5/17 (29%)
7tm_4 374..620 CDD:304433 56/284 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.