Sequence 1: | NP_648181.2 | Gene: | mthl7 / 38910 | FlyBaseID: | FBgn0035847 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001124512.1 | Gene: | gpr157 / 100038048 | XenbaseID: | XB-GENE-492646 | Length: | 323 | Species: | Xenopus tropicalis |
Alignment Length: | 227 | Identity: | 44/227 - (19%) |
---|---|---|---|
Similarity: | 84/227 - (37%) | Gaps: | 74/227 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 208 WIIRHRCTSHISPGSLEILIITMICFV------LTIAVYLYIKKLRNVTGKCIVCCIVSRFIQCL 266
Fly 267 IMILDHLNLLNGICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWST 331
Fly 332 AAIMTGSIYIV--NQIWENDPSKW----NW-LPLV-----------GF-----------IRCSVK 367
Fly 368 DWHPSVWIYISGPSLALSTFNVAMFALTAIYI 399 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mthl7 | NP_648181.2 | Mth_Ecto | 27..214 | CDD:299804 | 1/5 (20%) |
gpr157 | NP_001124512.1 | 7tm_GPCRs | 17..>192 | CDD:391938 | 40/209 (19%) |
TM helix 1 | 17..39 | CDD:341315 | 5/21 (24%) | ||
TM helix 2 | 48..69 | CDD:341315 | 6/27 (22%) | ||
TM helix 3 | 81..103 | CDD:341315 | 5/25 (20%) | ||
TM helix 4 | 123..139 | CDD:341315 | 5/15 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 49 | 1.000 | Inparanoid score | I5275 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |