DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and gpr157

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001124512.1 Gene:gpr157 / 100038048 XenbaseID:XB-GENE-492646 Length:323 Species:Xenopus tropicalis


Alignment Length:227 Identity:44/227 - (19%)
Similarity:84/227 - (37%) Gaps:74/227 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 WIIRHRCTSHISPGSLEILIITMICFV------LTIAVYLYIKKLRNVTGKCIVCCIVSRFIQCL 266
            |::..|...::|    |.:|:.:.|.:      |.|..|:..:.||:..             :.|
 Frog     3 WLVIPREDLNVS----EQVIVLLSCVLSFLGSALIIVTYILWQDLRSRP-------------RLL 50

  Fly   267 IMILDHLNLLNGICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWST 331
            ::.|...:||:.:       |:|:.:..|...|     ||..:|.    .....|...::|.|:.
 Frog    51 LLFLSVADLLSAL-------SYFYGVLRNFQDS-----TWDCVTQ----GAISTFSNTSSFFWTV 99

  Fly   332 AAIMTGSIYIV--NQIWENDPSKW----NW-LPLV-----------GF-----------IRCSVK 367
            |..:...|.||  .|.:.:....|    :| :|||           |:           ::..|:
 Frog   100 AVAVYLYITIVKSQQSFADQIIPWLHLISWGVPLVITLSAVCLKKIGYDASYVSVGWCWVKIDVE 164

  Fly   368 DWHPSVWIYISGPSLALSTFNVAMFALTAIYI 399
            |  ..:|:.::|....:    :|...|..:||
 Frog   165 D--KLLWMLLAGKVWEI----LAYLILPVLYI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 1/5 (20%)
gpr157NP_001124512.1 7tm_GPCRs 17..>192 CDD:391938 40/209 (19%)
TM helix 1 17..39 CDD:341315 5/21 (24%)
TM helix 2 48..69 CDD:341315 6/27 (22%)
TM helix 3 81..103 CDD:341315 5/25 (20%)
TM helix 4 123..139 CDD:341315 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.