DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmt and AT2G44175

DIOPT Version :9

Sequence 1:NP_523969.1 Gene:Nmt / 38909 FlyBaseID:FBgn0020392 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_850413.1 Gene:AT2G44175 / 819024 AraportID:AT2G44175 Length:115 Species:Arabidopsis thaliana


Alignment Length:48 Identity:19/48 - (39%)
Similarity:28/48 - (58%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 IEPNKEISEIRALPYTLPGGFKWVTLDLNDANDLKELYTLLNENYVED 159
            :||...:|||:..|..||.|::|:|.|||..:...|:...|.|.|:.|
plant    49 VEPANPLSEIKQEPEKLPCGYEWITCDLNTDDMCSEVCKFLKEQYLVD 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NmtNP_523969.1 NMT 112..268 CDD:279562 19/48 (40%)
NMT_C 284..459 CDD:280893
AT2G44175NP_850413.1 NMT 48..>96 CDD:279562 18/46 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1025421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.