powered by:
Protein Alignment Nmt and AT2G44175
DIOPT Version :9
Sequence 1: | NP_523969.1 |
Gene: | Nmt / 38909 |
FlyBaseID: | FBgn0020392 |
Length: | 472 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_850413.1 |
Gene: | AT2G44175 / 819024 |
AraportID: | AT2G44175 |
Length: | 115 |
Species: | Arabidopsis thaliana |
Alignment Length: | 48 |
Identity: | 19/48 - (39%) |
Similarity: | 28/48 - (58%) |
Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 IEPNKEISEIRALPYTLPGGFKWVTLDLNDANDLKELYTLLNENYVED 159
:||...:|||:..|..||.|::|:|.|||..:...|:...|.|.|:.|
plant 49 VEPANPLSEIKQEPEKLPCGYEWITCDLNTDDMCSEVCKFLKEQYLVD 96
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Nmt | NP_523969.1 |
NMT |
112..268 |
CDD:279562 |
19/48 (40%) |
NMT_C |
284..459 |
CDD:280893 |
|
AT2G44175 | NP_850413.1 |
NMT |
48..>96 |
CDD:279562 |
18/46 (39%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1025421at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.