DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13675 and CG14304

DIOPT Version :9

Sequence 1:NP_001261563.1 Gene:CG13675 / 38907 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001138080.1 Gene:CG14304 / 42232 FlyBaseID:FBgn0038629 Length:1136 Species:Drosophila melanogaster


Alignment Length:268 Identity:73/268 - (27%)
Similarity:117/268 - (43%) Gaps:67/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GEDYPAYDAVPKGLAFNC-QGRQPGYYADTETRCQVWHWCLHSGHQYSFLCPNGTVFNQAVRVCD 118
            |.|||.|..:|: .:|.| :.|..|::.|.||.|||||:|..:|.:.||||||||:|:|....||
  Fly   847 GIDYPNYAEIPQ-TSFECTKQRYKGFFGDPETNCQVWHYCDLNGGKASFLCPNGTIFSQIALTCD 910

  Fly   119 WWSNVNCEGSEQLYQNNDELYR--IPERQQQLNDVXYEADDEY---KIGTANGTRQRGGRQRQFQ 178
            ||.||.|..:.|||..|:.||:  :|...:...|......|:|   |.       |....:.:.:
  Fly   911 WWFNVKCSTTAQLYVLNERLYKYILPFNPKFPEDYNGPIVDKYLAMKF-------QEMEEKMRLE 968

  Fly   179 KQQQQKQQ-QQQHQALNSNTAI-----------GGINS--------SNRIVDS-----------S 212
            ||::..|: |:..:|.::..|:           .|||:        .|.::|.           .
  Fly   969 KQRKAAQEAQKPEEAPSTLPALPKNHKPEPKHGSGINAQVYEQSSEKNLLIDDEIDDISERGTYD 1033

  Fly   213 NYSK------MTKNSFRGSMRF--------TTPSTNPQSSY--------SSSQQQQQQQQQQQKQ 255
            .|.:      |...|.:.:..|        :||...|:..:        ||.::...|..::.|:
  Fly  1034 TYDQTAPTTIMAPTSTQDTQSFVLKPIVVSSTPQPLPEIDFEVEPTAPGSSEEEDHLQSLRETKE 1098

  Fly   256 HQKQHNSS 263
            .:|:...|
  Fly  1099 AEKKTRES 1106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 29/53 (55%)
CG14304NP_001138080.1 CBM_14 863..917 CDD:279884 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.