DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13675 and CG14880

DIOPT Version :9

Sequence 1:NP_001261563.1 Gene:CG13675 / 38907 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_650538.1 Gene:CG14880 / 41986 FlyBaseID:FBgn0038422 Length:637 Species:Drosophila melanogaster


Alignment Length:302 Identity:76/302 - (25%)
Similarity:124/302 - (41%) Gaps:60/302 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AYDAVPK---------GLAFNCQGRQPGYYADTETRCQVWHWCLHSGHQYSFLCPNGTVFNQAVR 115
            |.:|:||         ..:|:|.||..|||||.||.|||:|.|...|.|:|:.|||.|:|.|.:.
  Fly    30 AQNAIPKTNPASLLIQKTSFSCAGRPAGYYADVETGCQVYHMCDGLGRQFSYTCPNTTLFQQRML 94

  Fly   116 VCDWWSNVNCEGSEQLYQNNDELYRIPERQQQLNDVXYEADDEYKIGTANGTRQRGGRQRQFQKQ 180
            :||.|..|||..:|..|..|   ..|.:|     |..:..|:|..:.|.....    ..|.:...
  Fly    95 ICDHWYMVNCSKAESNYAAN---LLIGQR-----DKPFVNDEENSLRTPRPDL----LDRPYAPD 147

  Fly   181 QQQKQQQQQHQALNSNTAIGGINSSNRIVDSS--------NYSKMTKNSFR---GSMRFTTPSTN 234
            ...:..:.|::...||        .|:|.|.|        :..::::..:|   .|.....|:..
  Fly   148 YSGESFRSQYKQFTSN--------QNQIRDESVKGAGAGKSDPQISQTRWRIPPPSRTILPPAYE 204

  Fly   235 PQSSYSSSQQQQQQQQQQQKQHQKQHNSSRNSER---KSKPSSVNHRDRDSNQT-------RSRN 289
            ||....|:        |..|.......|:..:.|   .::|::.......:..|       |.:.
  Fly   205 PQIELPSA--------QSAKPRIPIITSTTTTTRATTTTRPTTTTRATTTTTTTRRPPVTARPKE 261

  Fly   290 RTHNTPQSGKKNNSNNNSSRGKQRYNTNKFENDAE--LKDYK 329
            ..||...:.::::.::..:....||||:...|.||  |::.|
  Fly   262 ALHNRRPNFQEHDMDDLGTSHSTRYNTSADFNSAESPLRETK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 28/52 (54%)
CG14880NP_650538.1 CBM_14 51..104 CDD:279884 28/52 (54%)
COG3979 336..>457 CDD:226487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.