DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13675 and CG14607

DIOPT Version :9

Sequence 1:NP_001261563.1 Gene:CG13675 / 38907 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_649709.2 Gene:CG14607 / 40869 FlyBaseID:FBgn0037488 Length:401 Species:Drosophila melanogaster


Alignment Length:202 Identity:68/202 - (33%)
Similarity:92/202 - (45%) Gaps:43/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DG-YTA-----GEDYPAYDAVPKGLAFNC-QGRQPGYYADTETRCQVWHWCLHSGHQYSFLCPNG 107
            || |:|     |.|||.|..||: ..|:| |...||||||.|.:|||:|.|. ....||||||||
  Fly   163 DGDYSAIPGVPGVDYPIYAQVPR-TNFDCAQQPLPGYYADIEAQCQVFHICA-LNRTYSFLCPNG 225

  Fly   108 TVFNQAVRVCDWWSNVNCEGSEQLYQNNDELYRIPERQQQLNDVXYEADDEYKIGTANGTRQRGG 172
            |||:|...||.||:..:|..:..||.||..:|...||                    :|:..|..
  Fly   226 TVFSQETLVCVWWNQYDCVSAPSLYANNAYIYDYSER--------------------SGSNLRTS 270

  Fly   173 RQRQFQKQQQQKQQQQQHQALNSNTAIGGINSSNRIVDSSNYSKMT-KNSFRGS--MRFTTPSTN 234
            ......:           .|.:|:.|.|...::...:.::..|::. .||.|||  ....||:..
  Fly   271 NTNNVYR-----------PAASSSAAFGAPLATTGTLRATGVSQVAGYNSGRGSYPSATPTPTAQ 324

  Fly   235 PQSSYSS 241
            |||.|.:
  Fly   325 PQSPYGA 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 30/53 (57%)
CG14607NP_649709.2 CBM_14 190..243 CDD:279884 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472731
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.