DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13675 and thw

DIOPT Version :9

Sequence 1:NP_001261563.1 Gene:CG13675 / 38907 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001097699.2 Gene:thw / 40868 FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster


Alignment Length:375 Identity:90/375 - (24%)
Similarity:137/375 - (36%) Gaps:96/375 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ATTTAANKSPQQQQ------HRRQQHLQWSACIMIVVFGLFSMLAGNCVNGQIDGYTAGEDYPAY 61
            |..|.|.:..:::.      :..:.||:..|....|.:.::..:.|.          .|.|:|.|
  Fly    48 AKQTGATQFEEERYEAHTNCNEHKHHLKKRASDEDVDYEVYQGVVGR----------PGIDFPIY 102

  Fly    62 DAVPKGLAFNCQGRQPGYYADTETRCQVWHWCLHSGHQYSFLCPNGTVFNQAVRVCDWWSNVNCE 126
            ..:|| .:|:|:....||:||.||.|||:|.| ..|.:.||||||||:|.|:...||||..|||.
  Fly   103 PRIPK-TSFSCRSYGNGYFADMETDCQVFHIC-EEGRKISFLCPNGTIFQQSELTCDWWFKVNCL 165

  Fly   127 GSEQLYQNNDELYRIPERQQQLNDVXYEADDEYKIGTANGTRQRGGRQRQFQKQQQQKQQQQQHQ 191
            ||...|..:.|:         ||                  :||..|.|.....|          
  Fly   166 GSSGYYAESAEI---------LN------------------KQRVHRVRPSVPVQ---------- 193

  Fly   192 ALNSNTAIGGINSSNRIVDSSNYSKMTKNSFRGSMRFTTPSTNPQSSYSSSQQ----------QQ 246
              ..|...||:|...::...:           |..|...|..||.....|::.          ..
  Fly   194 --GFNIVGGGLNIKPKVTPVA-----------GQGRSAAPRANPDRRIDSTEDVPASVESVDFDD 245

  Fly   247 QQQQQQQKQHQKQHNSSRNSE-----------------RKSKPSSVNHRDRDSNQTRSRNRTH-N 293
            ...::|:|......|:|.:.|                 |.:|.|:.|..|..:....:|.||. .
  Fly   246 VSGEKQRKVLPSIDNNSNDQESQITAESSSFVSGSGKRRTNKESNPNRNDDITVLKPARLRTPVA 310

  Fly   294 TPQSGKKNNSNNNSSRGKQRYNTNKFENDAELKDYKSKIKNKYNIDYDHS 343
            |.:.|.......|..||:.||:.::..:....:....:.|.|......||
  Fly   311 TQERGVSTERARNGQRGQHRYSGSEEHSKERERPTPGQSKEKPEFFEAHS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 28/52 (54%)
thwNP_001097699.2 CBM_14 112..164 CDD:279884 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.