DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13675 and ckd

DIOPT Version :9

Sequence 1:NP_001261563.1 Gene:CG13675 / 38907 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_647796.2 Gene:ckd / 38402 FlyBaseID:FBgn0035427 Length:140 Species:Drosophila melanogaster


Alignment Length:91 Identity:34/91 - (37%)
Similarity:48/91 - (52%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 AFNCQGRQPGYYADTETRCQVWHWCLHSGHQYSFLCPNGTVFNQAVRVCDWWSNVNCEGSEQLYQ 133
            :|:|:.|..|:|||.|..||::|.|...|::...||.|.|.|||..|:|||..|.||..|.:.:.
  Fly    58 SFDCKRRSVGFYADMEYNCQIFHMCDEEGNRIPHLCANETSFNQEYRICDWDYNFNCTESPKWFY 122

  Fly   134 NNDELYRIPERQQQLNDVXYEADDEY 159
            .|:..|        ..|. .|.|::|
  Fly   123 LNELTY--------ATDPPDEDDEDY 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 24/52 (46%)
ckdNP_647796.2 CBM_14 61..111 CDD:279884 23/49 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.