DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13675 and CG8192

DIOPT Version :9

Sequence 1:NP_001261563.1 Gene:CG13675 / 38907 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_611047.2 Gene:CG8192 / 36723 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster


Alignment Length:229 Identity:62/229 - (27%)
Similarity:96/229 - (41%) Gaps:57/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 AFNCQGRQPGYYADTETRCQVWHWCLHSGHQYSFLCPNGTVFNQAVRVCDWWSNVN-CEGSEQLY 132
            :|:|..|..|||||....|:|:|:|..| .::|::||.|..|:|...:|...|:.| |:.|.:.:
  Fly   144 SFSCTDRNSGYYADESLSCEVFHYCQES-QKHSWICPEGFTFHQIHLICMPPSHDNICKQSSKYH 207

  Fly   133 QNNDELYR---IPERQQQLN-----------DVXYE----ADDEYKIGTANGTRQRGGRQRQFQK 179
            ..||.||:   :.|.|.:.|           :..||    .|:|.::..|    .|...|:|..:
  Fly   208 IVNDYLYKPINLQEHQSKPNVTLRYSERYFPENYYEHERYDDEEEQLPAA----PRPRIQQQHHQ 268

  Fly   180 QQQQKQQQQQHQALNSNTAIGGINSSNRIVDSSNYSKMTKNSFRGSMRFTTPSTNPQSSYSSSQQ 244
            ||.|:.|||..|.|                                 .:..|...||......|.
  Fly   269 QQHQQPQQQHRQVL---------------------------------AYQQPQQQPQVRVQYQQP 300

  Fly   245 QQQQQQQQQKQHQKQHNSSRNSERKSKPSSVNHR 278
            ||.|..|||.|.|.|..:....:.:.:|:::.:|
  Fly   301 QQHQHHQQQAQPQAQVVTQIRHQPQPQPTTLAYR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 21/53 (40%)
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.