DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13676 and nucks1a

DIOPT Version :9

Sequence 1:NP_648179.3 Gene:CG13676 / 38906 FlyBaseID:FBgn0035844 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001004601.1 Gene:nucks1a / 447862 ZFINID:ZDB-GENE-040912-175 Length:305 Species:Danio rerio


Alignment Length:379 Identity:74/379 - (19%)
Similarity:134/379 - (35%) Gaps:135/379 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 RPLRRPYNRRPIDDYYYEDQDQYEDDYYEE-----RPVRRPKPRPRQRKPQVEPEYDDEYDDKRT 287
            ||:|   ||:.::...:.:.|..::||..:     :.:|.|....:.:|.:...|..::.|:|.|
Zfish     3 RPVR---NRKVVNYSQFNESDDADEDYGRKEKETTKKIRAPPRENKHKKSKNSQEESEDSDEKLT 64

  Fly   288 EAKKPIR------RNRNRYRDEEEALDEDYDERPSKRPRGKPTAGTAGRKISPRKPGRVEERRSF 346
            ::|....      .:.:...::||....||.::.:|:.: ||.....|:|...||.|..:.    
Zfish    65 KSKNDSADDFGSDEDNDFGEEQEEDGGSDYGDKKAKKGK-KPKVEKPGKKSLKRKRGGDDS---- 124

  Fly   347 NEDRPLGRRRSEKERTTPSSAL---------------DDLDEYEKPYNSADQVEAAEE------- 389
            ::|:.:. |:..:.|...|.|:               ::.||.|:.:  .||...::|       
Zfish   125 DDDKEVS-RKPRQVRQAASKAVSKQREILLGDGGSEDEEKDEEEQAF--LDQESGSDEDFMVDDD 186

  Fly   390 ----------------------QTPQKVKTTPKP-LTEFITPKAAAASVYARPRAPPRIARPVPI 431
                                  :..:|.|.:||| |...:.|.........||.|...:.:..|.
Zfish   187 DDSDYGHSKKKGKKVVPRGGGRRVEKKEKKSPKPRLKATVNPSPMKGKGKGRPSAAKALEKSSPK 251

  Fly   432 NEKKKFSYPVQKITATTQAPSNSAQEEEDYPEEQVEEDYEQPPARNTPRRRTPASRAEQKPTRTT 496
            :|:              :|.|.:..||||..|::     |.||::.|                  
Zfish   252 DEE--------------EAESPAEDEEEDEVEKK-----ESPPSKKT------------------ 279

  Fly   497 LRKPVTDKKPVDEEYDEPAEPEPLRKRKRPLAPRSRVPAADVDFEDEEYEESPA 550
                 .|:.|.|||.||.                          ||...||:|:
Zfish   280 -----KDEAPEDEEEDEE--------------------------EDGSEEEAPS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13676NP_648179.3 CBM_14 130..182 CDD:279884
nucks1aNP_001004601.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.