DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13676 and CG14607

DIOPT Version :9

Sequence 1:NP_648179.3 Gene:CG13676 / 38906 FlyBaseID:FBgn0035844 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_649709.2 Gene:CG14607 / 40869 FlyBaseID:FBgn0037488 Length:401 Species:Drosophila melanogaster


Alignment Length:275 Identity:64/275 - (23%)
Similarity:98/275 - (35%) Gaps:82/275 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SLLASTDAALPFKKVSIAKTPVSTSSTTSTTTEAPAVEEEEVEEEQPV----PTADSSDGSKSDN 79
            :::.:|:...|.::.|  ...:||.|:.|......|.:........|:    .|.||.|.:.||.
  Fly   102 AIVGATNPVNPPRRTS--SGGLSTPSSRSGPYGPQASQYGGTPGGSPIRVASGTGDSGDYNDSDG 164

  Fly    80 GTLLKNSKLTGIPQIDYIWDPNLPRELRGYNLSTYPFLSTVPPMDEIHFKC-EGLHDGFYASIEY 143
                ..|.:.|:|.:|                  ||..:.||   ..:|.| :....|:||.||.
  Fly   165 ----DYSAIPGVPGVD------------------YPIYAQVP---RTNFDCAQQPLPGYYADIEA 204

  Fly   144 KCQIYHHCVYGIRHDFLCANFTAFDQRTFICHFASDVDCEGSQKYWNRNDELY------------ 196
            :||::|.|.....:.|||.|.|.|.|.|.:|.:.:..||..:...:..|..:|            
  Fly   205 QCQVFHICALNRTYSFLCPNGTVFSQETLVCVWWNQYDCVSAPSLYANNAYIYDYSERSGSNLRT 269

  Fly   197 --------------------MATTTTSTSTTTTPAP---------PTLPPAPRRRPQRPQ----- 227
                                :|||.|..:|..:...         |:..|.|..:||.|.     
  Fly   270 SNTNNVYRPAASSSAAFGAPLATTGTLRATGVSQVAGYNSGRGSYPSATPTPTAQPQSPYGAGAV 334

  Fly   228 -RPLRRP---YNRRP 238
             ||...|   .||.|
  Fly   335 LRPAIVPSTGANRLP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13676NP_648179.3 CBM_14 130..182 CDD:279884 19/52 (37%)
CG14607NP_649709.2 CBM_14 190..243 CDD:279884 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.