DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13676 and CG32036

DIOPT Version :9

Sequence 1:NP_648179.3 Gene:CG13676 / 38906 FlyBaseID:FBgn0035844 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster


Alignment Length:145 Identity:39/145 - (26%)
Similarity:59/145 - (40%) Gaps:44/145 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SKLTGIPQIDYIWDPNLPRELRGYNLSTYPFLSTVPPMDEIHFKCEGL--HDGFYASIEYKCQIY 148
            :|:.|:|.:|                  ||....||   ..||.|..:  ..|.||::|..||.|
  Fly    49 NKIPGVPGVD------------------YPIYHEVP---HTHFSCHNVPATPGMYANVETGCQAY 92

  Fly   149 HHCVYGIRHD----FLCANFTAFDQRTFICHFASDVDCEGSQKYWNRNDELYMATTTTSTSTTTT 209
            |.|..|...|    |||.|.|.|:|:.|.|.:..:|.||.:..:::.|.:               
  Fly    93 HVCHDGREGDQGAKFLCTNGTIFNQKEFACDWWYNVKCEEATHFYHLNAD--------------- 142

  Fly   210 PAPPTLPPAPRRRPQ 224
              |...|..|:::|:
  Fly   143 --PEHNPYIPKKKPE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13676NP_648179.3 CBM_14 130..182 CDD:279884 22/57 (39%)
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 21/49 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.