DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13676 and CG13675

DIOPT Version :9

Sequence 1:NP_648179.3 Gene:CG13676 / 38906 FlyBaseID:FBgn0035844 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001261563.1 Gene:CG13675 / 38907 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster


Alignment Length:425 Identity:87/425 - (20%)
Similarity:155/425 - (36%) Gaps:140/425 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ELRGYNL-STYPFLSTVPPMDEIHFKCEGLHDGFYASIEYKCQIYHHCVY-GIRHDFLCANFTAF 167
            ::.||.. ..||....||  ..:.|.|:|...|:||..|.:||::|.|:: |.::.|||.|.|.|
  Fly    48 QIDGYTAGEDYPAYDAVP--KGLAFNCQGRQPGYYADTETRCQVWHWCLHSGHQYSFLCPNGTVF 110

  Fly   168 DQRTFICHFASDVDCEGSQKYWNRNDELYMATTTTSTSTTTTPAPPTLPPAPRRRPQRPQRPLRR 232
            :|...:|.:.|:|:||||::.:..|||||                        |.|:|.|:    
  Fly   111 NQAVRVCDWWSNVNCEGSEQLYQNNDELY------------------------RIPERQQQ---- 147

  Fly   233 PYNRRPIDDYYYEDQDQYEDDYYEERPVRRPKPRPRQRKPQVEPEYDDEYDDKRTEAKKPIRRNR 297
                  ::|. ||..|:|:.........|..:.|..|::.|                       :
  Fly   148 ------LNDVXYEADDEYKIGTANGTRQRGGRQRQFQKQQQ-----------------------Q 183

  Fly   298 NRYRDEEEALDEDYDERPSKRPRGKPTA----GTAGRKISPRKPGRVEERRSFNEDRPLGRRRSE 358
            .:.:.:.:||:.:             ||    .::.|.:......:: .:.||         |..
  Fly   184 KQQQQQHQALNSN-------------TAIGGINSSNRIVDSSNYSKM-TKNSF---------RGS 225

  Fly   359 KERTTPSSALDDLDEYEKPYNSADQVEAAEEQTPQKVKTTPKPLTEFITPKAAAASVYARPRAPP 423
            ...||||:         .|.:|....:..::|..|:.|...|.              :...|...
  Fly   226 MRFTTPST---------NPQSSYSSSQQQQQQQQQQQKQHQKQ--------------HNSSRNSE 267

  Fly   424 RIARPVPINEKKKFSYPVQKITATTQAP---------SNSAQEEEDYPEEQVEEDYEQPPARNTP 479
            |.::|..:|.:.:.|...:....|...|         :||::.::.|...:.|.|          
  Fly   268 RKSKPSSVNHRDRDSNQTRSRNRTHNTPQSGKKNNSNNNSSRGKQRYNTNKFEND---------- 322

  Fly   480 RRRTPASRAEQKPTRTTLRKP--VTDKKPVDEEYD 512
                    ||.|..::.::..  :.....:||||:
  Fly   323 --------AELKDYKSKIKNKYNIDYDHSLDEEYE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13676NP_648179.3 CBM_14 130..182 CDD:279884 21/52 (40%)
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.