DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus301 and tam

DIOPT Version :10

Sequence 1:NP_648178.1 Gene:mus301 / 38905 FlyBaseID:FBgn0002899 Length:1051 Species:Drosophila melanogaster
Sequence 2:XP_061513323.1 Gene:tam / 1272128 VectorBaseID:AGAMI1_013818 Length:1168 Species:Anopheles gambiae


Alignment Length:106 Identity:25/106 - (23%)
Similarity:36/106 - (33%) Gaps:44/106 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PSAQSVPPNS-------ASKPDEASAPTDKHQIDLADEENADKLFKKINLNDLSIAEMED----- 143
            ||...:.|:|       |.||..|..|.|:..                .||::||..:.|     
Mosquito    22 PSQSDILPHSTVRRLKVAPKPPPAKPPDDRGP----------------RLNEMSIQMLSDSLYRQ 70

  Fly   144 IFHGADDFSDPMVQNTQLFLDAMTFKKPKTPEKLLAPLKDD 184
            ||.       |..|:.:        ..|.:| .|:..|:||
Mosquito    71 IFR-------PTAQHGR--------HAPASP-TLVKSLRDD 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus301NP_648178.1 DEXHc_POLQ-like 247..449 CDD:350784
BRR2 255..828 CDD:440817
tamXP_061513323.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.