DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7504 and AT5G37160

DIOPT Version :9

Sequence 1:NP_001137907.1 Gene:CG7504 / 38904 FlyBaseID:FBgn0035842 Length:1676 Species:Drosophila melanogaster
Sequence 2:NP_198532.2 Gene:AT5G37160 / 833689 AraportID:AT5G37160 Length:455 Species:Arabidopsis thaliana


Alignment Length:487 Identity:94/487 - (19%)
Similarity:160/487 - (32%) Gaps:175/487 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   986 SVDAVAEQDV----LMPIPPEFDSFKNYREIFVPLMKLELLSTIERDYKINNKNTFSVSLINVET 1046
            |:..:..:|:    :|.||..|.|...|.:.|||.:..|..:.:...::..:|:..| .:::|||
plant    26 SLKDILNEDLSKEKIMTIPDRFSSVDEYSQCFVPHLLEETRTELFSSFRSLSKSPVS-RILSVET 89

  Fly  1047 QDMCYRLVTRVNSKPFGKFVLYTLYCCGMLKETFANLLELKFVSGNVFDLTFEILKQDISEEKLK 1111
            :.:.|.  .|.:.|.|....|                            :.:...|.:|.|.|..
plant    90 KVIEYS--GRSSIKWFHDIKL----------------------------MDYADDKNEIYEPKCG 124

  Fly  1112 NIKQLT------ARPVVDSL---------------RVELGALSAVHQLRSSPLCRRILKPTQTVN 1155
            :|..|:      .||.:|.|               ::.:....::.|......|..:.....|.|
plant   125 DIIALSPLSLTEERPRIDDLDPLLLGYVFSVYGDSKISVHFSRSISQSEKHTFCTGVFLINITTN 189

  Fly  1156 -----------------------EVSLPKQPFTFKGCH------------------KLNEHQENI 1179
                                   :.|..:|.|:   |.                  |||..||..
plant   190 TRIWNALHKDAADSTLIQSVLQEDASATEQCFS---CENDVDGSDSDRVVDIIRSAKLNSSQEAA 251

  Fly  1180 VLHTYQRIIDDLQPSLTLIQGPPGTGKSRVISELCLQTLYGNAAKT------------------- 1225
            :|...:......:.|:.||.|||||||::.::.| |.||.....||                   
plant   252 ILGFLKTRNCKHKESVKLIWGPPGTGKTKTVATL-LSTLMQLKCKTVVCAPTNTTIVAVASRLLS 315

  Fly  1226 LDRKILICAHSNTAVDHIVGLL--------GSVLRVMNRDQFHLLRFGMHEKMSHYSRPFSLEAH 1282
            |.::.::||.:|:|:..:|...        .|:|........:::..|..|:|...|....|...
plant   316 LSKETIVCAPTNSAIAEVVSRFEFSTLFYGTSILERTTYGMGNIVLSGNRERMGITSNKVLLNVF 380

  Fly  1283 FNKAKEQKLQRVSK----------------------ENAEILKKQH-NDLKDEIQQLKEKTNLTS 1324
            ||       .||||                      ||.|...:|| |:|:              
plant   381 FN-------DRVSKLGRLFLSTCGWKKRLESIIDFLENTETKYEQHVNELE-------------- 424

  Fly  1325 TYLLQQLQQKEKKLQLISNQLSPPLTQREEFE 1356
               |:::.:.|||.:.:..:....:.....||
plant   425 ---LERMTEDEKKKEEVEERTMQEVVNIPTFE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7504NP_001137907.1 FHA 4..96 CDD:238017
FHA <10..101 CDD:224630
AAA_11 1171..1428 CDD:289831 54/236 (23%)
AAA_19 1194..1251 CDD:289986 23/83 (28%)
YtxH <1293..1347 CDD:295162 15/76 (20%)
AAA_12 1435..1626 CDD:289832
AT5G37160NP_198532.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1112
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.