DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7504 and Ct55

DIOPT Version :9

Sequence 1:NP_001137907.1 Gene:CG7504 / 38904 FlyBaseID:FBgn0035842 Length:1676 Species:Drosophila melanogaster
Sequence 2:NP_083418.1 Gene:Ct55 / 75013 MGIID:1922263 Length:236 Species:Mus musculus


Alignment Length:162 Identity:37/162 - (22%)
Similarity:63/162 - (38%) Gaps:39/162 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 VLELNPYLYNKLTNKTANNEITRKKIHD------------GDCIELDTDTDR-RSISEAQ----- 255
            :..|..:...|...|.|..| .:|.:.|            |.|...|..|.. ||.::.:     
Mouse     5 ISRLRAFFQRKADPKEAKEE-RQKLLEDATSLQNKQGVVAGSCSNYDCMTKHTRSSADVETGDNP 68

  Fly   256 -KAED--PSAERE--------VDDEEEYDESFAMSQAVIREMKAEMHVSDGEEDFLLTNGMG--- 306
             |||.  |:|..|        |..:.::||.  .|::.:|.:.|.:....|:.|:   ||.|   
Mouse    69 LKAEPNLPAAVEEQSPRGLNAVTVDNDHDEE--PSESHMRILLASITSLVGDADY---NGHGFSF 128

  Fly   307 NLPEGSPSNQAYD-DIVYVSDSDDDELYDKVA 337
            :|.......:.|: |:|.:..||:.:...:.|
Mouse   129 SLDIACKDFKPYNGDLVEIEFSDEQDTQSRRA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7504NP_001137907.1 FHA 4..96 CDD:238017
FHA <10..101 CDD:224630
AAA_11 1171..1428 CDD:289831
AAA_19 1194..1251 CDD:289986
YtxH <1293..1347 CDD:295162
AAA_12 1435..1626 CDD:289832
Ct55NP_083418.1 S1-like 176..228 CDD:291136
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1112
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.