DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7504 and CG34323

DIOPT Version :9

Sequence 1:NP_001137907.1 Gene:CG7504 / 38904 FlyBaseID:FBgn0035842 Length:1676 Species:Drosophila melanogaster
Sequence 2:NP_001096962.1 Gene:CG34323 / 5740207 FlyBaseID:FBgn0085352 Length:112 Species:Drosophila melanogaster


Alignment Length:111 Identity:38/111 - (34%)
Similarity:62/111 - (55%) Gaps:8/111 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WYLEHVTTGARLILHNGTNLMGRHSRCRIILGGQYQFVSREHANIIVSEKGVEVESLNPLNGLFI 69
            :|||||.||.|:.|:.|..::||||.|..:|  :|.::||.||.|.|::..:.::.:...||:|:
  Fly     3 FYLEHVLTGDRINLNEGIQILGRHSSCTWVL--KYDYMSRYHALIHVNQGDIFIKEMETNNGIFL 65

  Fly    70 N--GGKLGDKINRLAVAEGSTISLGV-TGVNLN-EITGIHAIFILK 111
            |  ..::|.....:.|  |..:..|| .|:..: ||.....||.:|
  Fly    66 NYWPTRIGSSWCEVNV--GDVLYFGVQLGIEHDGEIPNTFGIFTVK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7504NP_001137907.1 FHA 4..96 CDD:238017 32/93 (34%)
FHA <10..101 CDD:224630 29/94 (31%)
AAA_11 1171..1428 CDD:289831
AAA_19 1194..1251 CDD:289986
YtxH <1293..1347 CDD:295162
AAA_12 1435..1626 CDD:289832
CG34323NP_001096962.1 FHA 22..87 CDD:278899 20/68 (29%)
FHA <24..95 CDD:224630 23/74 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.