DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7504 and helz2c

DIOPT Version :9

Sequence 1:NP_001137907.1 Gene:CG7504 / 38904 FlyBaseID:FBgn0035842 Length:1676 Species:Drosophila melanogaster
Sequence 2:NP_001018332.1 Gene:helz2c / 552926 ZFINID:ZDB-GENE-050508-3 Length:231 Species:Danio rerio


Alignment Length:166 Identity:43/166 - (25%)
Similarity:67/166 - (40%) Gaps:44/166 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1534 VAKLLTEMDKHMPSKRFSYGLISPYQNQCYALSQVIPSH--MNITPQTVDSYQGLEKDVIIISNA 1596
            ||.||.:.....|.   ...:::||..|...:...:...  .|:|..||...||.|...:|:|..
Zfish    60 VADLLIKQSGVSPE---HIAILTPYNAQVSEIKMTLEKKNVRNVTVCTVMKSQGSEWPYVIVSTV 121

  Fly  1597 RT-------------------RGCGFLTNYQRLNVALTRPRRCLVICGNFEDLKSVEMWRNLLD- 1641
            |:                   :..||:|:..::|||:||.:..|.|.||.:.|:..|:|..||| 
Zfish   122 RSCSTSDIQAYRVRPHKAWLGKRLGFVTDANQVNVAITRAQDGLCILGNSDLLRCCELWDRLLDH 186

  Fly  1642 ------------DAR-KRK------VYFNLDRDDVN 1658
                        |.| |.|      :|....::|:|
Zfish   187 YYRKSCVVNPASDIRVKAKASEGLAIYTGNQKEDIN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7504NP_001137907.1 FHA 4..96 CDD:238017
FHA <10..101 CDD:224630
AAA_11 1171..1428 CDD:289831
AAA_19 1194..1251 CDD:289986
YtxH <1293..1347 CDD:295162
AAA_12 1435..1626 CDD:289832 28/112 (25%)
helz2cNP_001018332.1 UvrD_C_2 <58..172 CDD:304668 30/114 (26%)
DNA2 <60..194 CDD:224037 36/136 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.