DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7504 and Y53F4B.10

DIOPT Version :9

Sequence 1:NP_001137907.1 Gene:CG7504 / 38904 FlyBaseID:FBgn0035842 Length:1676 Species:Drosophila melanogaster
Sequence 2:NP_001366964.1 Gene:Y53F4B.10 / 190212 WormBaseID:WBGene00013157 Length:471 Species:Caenorhabditis elegans


Alignment Length:385 Identity:80/385 - (20%)
Similarity:138/385 - (35%) Gaps:119/385 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 SDSDDDELYDKVADW-----SKLLSQKVVPDVIE------------MSQTYPLENEHKDSDSDLD 372
            ||::...:..||::.     |..::.|.||:.:|            :|..:|.|:.:.| ..:::
 Worm    26 SDNNIQSITHKVSEMKLDTVSVPVNSKFVPNNLESKTISAKLKDPILSDRHPFEDYYHD-QQNVE 89

  Fly   373 IGAKKPKRTLRISSSSDEDSA--DEVIVHQTKQKGRRSKSKSPNDHVVRQADSTTPDLPAVRKLS 435
            ..::.|.:.|.::::.|:..|  :|.|... |:.||        .|:...|||..|.|.......
 Worm    90 QNSENPVKRLLLNTNLDDIQAFRNETIPCM-KKPGR--------CHMRIPADSQRPPLSFFCGAK 145

  Fly   436 VSSIDSVYENKQTKLNSKLKSCLKS-PTKTSVDNMENMTETKSCSN----RQREQIVAS------ 489
            .|...::|...|...:.|..|..|. |..   |..:..:...||.:    .:|:.:|:.      
 Worm   146 PSQPYALYVVAQGGTSLKCFSVFKELPAD---DRPDLFSADLSCFSYDILSERQAVVSDFLIGDL 207

  Fly   490 -----------------RNEPTNICPQKIETNKTSTRKRFV----STTSRDELSTTSKEIKDAPK 533
                             ..:.|::.  |:|::|..:.::|.    ..|..:..|......| |.|
 Worm   208 IIVFSLEVRYGVPPDSYLRDSTHVL--KLESHKYWSIEKFAVVQRCVTQPEPFSVHQSHFK-ADK 269

  Fly   534 -----NNV----EPPKKMLRSRSKSC------YID-----------RPVELDEHITKNEVPLKKK 572
                 ||:    ..|.|:|   .:||      ::.           :|..|.|.:.:....|...
 Worm   270 RLILVNNILTPLTVPTKLL---GESCRGVVRAFLPQAAPGLTLSSLKPGVLYEEVRRRTAHLGSH 331

  Fly   573 YES----------VDNSK------EELI-VTLEAPAML-----TTPTK-SKTQCVKKKAT 609
            :|:          |||..      ||.| |..||.|.|     |.||| .|..|..:..|
 Worm   332 WEAMSPQVLDLEVVDNGSMLSRLVEECIDVNTEAIATLYEDRGTHPTKVEKVTCGLRTVT 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7504NP_001137907.1 FHA 4..96 CDD:238017
FHA <10..101 CDD:224630
AAA_11 1171..1428 CDD:289831
AAA_19 1194..1251 CDD:289986
YtxH <1293..1347 CDD:295162
AAA_12 1435..1626 CDD:289832
Y53F4B.10NP_001366964.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1112
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.