DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7504 and R03D7.2

DIOPT Version :9

Sequence 1:NP_001137907.1 Gene:CG7504 / 38904 FlyBaseID:FBgn0035842 Length:1676 Species:Drosophila melanogaster
Sequence 2:NP_001364577.1 Gene:R03D7.2 / 174682 WormBaseID:WBGene00010989 Length:390 Species:Caenorhabditis elegans


Alignment Length:349 Identity:93/349 - (26%)
Similarity:145/349 - (41%) Gaps:83/349 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1373 SSCVKLA-------NYVDFFDICIVDEATQCT-----EPWTLLPMRFGLTHMVLVGDMQQLPAVV 1425
            ::.:|||       ...|.|||..:|||:|..     ...|:||.    :.|:|||||.|||..:
 Worm    45 AAAIKLAFSQAPFLEIKDRFDITFIDEASQLALYVLGSLATMLPK----SRMILVGDMHQLPPYM 105

  Fly  1426 -------LSKKAIDFGLSNSMFDRIQRSLQTQLDKPGSYHLMHTKLFKLSTQYRMHPEICRWPNQ 1483
                   |.:.||...|:.::             |...:..||     |:..:|....|......
 Worm   106 EEALPAELKRAAIGEPLTLAV-------------KGRRWPSMH-----LTRVHRCPKMITEVLGD 152

  Fly  1484 YFYEDQLINAECTARFASPL----IP--YCVINLKYTCDSNGAQNKSISNNEEARFVAKLLTEMD 1542
            .||.:.|.:::........|    :|  :.::.:.||.... |..||.||..|||:..:|:..:.
 Worm   153 LFYGNTLTSSKPGVTDIPVLKAMGLPSRHPMVFVNYTSPQT-AVGKSFSNEGEARYALQLVEALT 216

  Fly  1543 KH--MPSKRFSYGLISPYQNQ-CYALSQVIPSHMNITPQTVDSYQGLEKDVIIISNART---RGC 1601
            ::  ..:|:.:..:::.|..| .|..|.   :...:|..|:|..||.|.||.|:...|:   ...
 Worm   217 RYASTANKKITAAILNFYGAQYSYVYSM---AEDEVTVNTIDGCQGQEYDVTIVLLTRSDPYERS 278

  Fly  1602 GFLTNYQRLNVALTRPRRCLVI------CGNFEDLKS--------VEMWRNLLD--------DAR 1644
            .||.|..|:||||:||:...||      .||..|.:.        |..|..|::        || 
 Worm   279 KFLVNANRINVALSRPKIATVIIGQRHLTGNQPDPRQPKRGRHQRVCNWARLIEKLPKECFVDA- 342

  Fly  1645 KRKVYFNLDRDDVN---DLDRSLI 1665
            |.:|....||.:|:   |..|||:
 Worm   343 KDQVIAQEDRSEVSHALDPTRSLL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7504NP_001137907.1 FHA 4..96 CDD:238017
FHA <10..101 CDD:224630
AAA_11 1171..1428 CDD:289831 24/73 (33%)
AAA_19 1194..1251 CDD:289986
YtxH <1293..1347 CDD:295162
AAA_12 1435..1626 CDD:289832 50/208 (24%)
R03D7.2NP_001364577.1 DNA2 <19..302 CDD:224037 76/282 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1112
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.