DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7504 and AgaP_AGAP011894

DIOPT Version :9

Sequence 1:NP_001137907.1 Gene:CG7504 / 38904 FlyBaseID:FBgn0035842 Length:1676 Species:Drosophila melanogaster
Sequence 2:XP_320632.3 Gene:AgaP_AGAP011894 / 1280766 VectorBaseID:AGAP011894 Length:147 Species:Anopheles gambiae


Alignment Length:165 Identity:34/165 - (20%)
Similarity:63/165 - (38%) Gaps:58/165 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   952 ERREWIRRENKPVNDIRQHSRSILKWAN------QWLKHGSVDAVAEQDVLMPIPPEFDSFKNYR 1010
            |:|....|..||.   ||..:|.||...      ||::  |...:.|......:|.         
Mosquito     4 EQRATTARGGKPA---RQSRKSHLKRTGTTRCLLQWVE--SAINIPESRTPQIVPK--------- 54

  Fly  1011 EIFVPLMKLELLSTIERDYKINNKNTFSV--SLINVETQDMCYRLVTRVNSKPFGKFVLYTLYCC 1073
                |:.::    |:|          ||:  |:|.::.|:.|.:::           :|.::|  
Mosquito    55 ----PVFRM----TVE----------FSITQSMITIKVQNFCSQIL-----------ILRSIY-- 88

  Fly  1074 GMLKETFANLL----ELKFVSGNVFDLTFEILKQD 1104
             :..||...::    .|:.|.|..|.:..||.:::
Mosquito    89 -LYYETSKRVVLFGGVLRMVPGYEFAMEKEIHEKE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7504NP_001137907.1 FHA 4..96 CDD:238017
FHA <10..101 CDD:224630
AAA_11 1171..1428 CDD:289831
AAA_19 1194..1251 CDD:289986
YtxH <1293..1347 CDD:295162
AAA_12 1435..1626 CDD:289832
AgaP_AGAP011894XP_320632.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000219
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.