DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7504 and ush1g

DIOPT Version :9

Sequence 1:NP_001137907.1 Gene:CG7504 / 38904 FlyBaseID:FBgn0035842 Length:1676 Species:Drosophila melanogaster
Sequence 2:XP_004918532.1 Gene:ush1g / 100494764 XenbaseID:XB-GENE-1013607 Length:465 Species:Xenopus tropicalis


Alignment Length:305 Identity:63/305 - (20%)
Similarity:102/305 - (33%) Gaps:70/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 IETNKTSTRKRFVSTTSRDELSTTSKEIKDAPKNNVEPPKKMLRSRSKSCYIDRPVELDEHITKN 565
            |...:|....:.||...........|.|:|..|...:..::|.| |.:....||...:.  .:..
 Frog   120 IAAKQTGLNPKLVSKLKERAFREAEKRIRDCAKLQRKHHERMER-RYRRDMSDRSDTMS--FSSY 181

  Fly   566 EVPLKKKYESVDNSKEELIVTLEAPAMLTTP-------TKSKTQCVKK--KATQTRGRRKTIH-S 620
            ...:.::|.|             |....|.|       ||.||:..||  |..||.|..|... .
 Frog   182 SSSVSQRYPS-------------ATMFPTMPYSHAAGTTKGKTKIQKKLEKRKQTDGMFKIYEDG 233

  Fly   621 RDEIRSLTAEAEENKKISPAKQTNEEIPIPTKSPLKRNARLLNRSKSCYMDRLVISETEDPAKKV 685
            |..:|||:.....|..:...:.|       ..||.:|..:.|         |.:....||...:.
 Frog   234 RKSVRSLSGLQLGNDVMFVKQGT-------YASPRERGRQHL---------RDMFLPEEDSLSRA 282

  Fly   686 IKDISPTKSD------TTDNVLNFVDVRQTRGPSVIEAPSL---------PKNRGKLRGVSAEVK 735
            |.|......|      :||:..:.:..|...|..|.....|         .:..|...|:..|||
 Frog   283 ISDPGLHGGDSAHSEVSTDSGHDSLFTRPGLGTMVFRRNYLSSGLFGMGRDEGNGLQPGLGEEVK 347

  Fly   736 VKDKVLDRQRFID----------YQAEMNAKWKQKPKDKKKEDEK 770
            ::.: |.|...:|          .:.|....|::  :|.:.:|::
 Frog   348 LRSR-LKRSPSLDDSIGSAGSLAVRNEQELPWEE--EDLRLDDDE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7504NP_001137907.1 FHA 4..96 CDD:238017
FHA <10..101 CDD:224630
AAA_11 1171..1428 CDD:289831
AAA_19 1194..1251 CDD:289986
YtxH <1293..1347 CDD:295162
AAA_12 1435..1626 CDD:289832
ush1gXP_004918532.1 Ank_4 5..49 CDD:372654
ANK repeat 31..62 CDD:293786
Ank_2 38..117 CDD:372319
ANK repeat 64..95 CDD:293786
SAM_USH1G 392..457 CDD:188985
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1112
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.