DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and ACTR8

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_075050.3 Gene:ACTR8 / 93973 HGNCID:14672 Length:624 Species:Homo sapiens


Alignment Length:487 Identity:84/487 - (17%)
Similarity:158/487 - (32%) Gaps:159/487 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DFFIGDEAFDATG---YSIKYPVRHG--------------LVEDWDLMERFLEQCVFKYLRAEPE 106
            ::.:|:||.....   |:|.:|:|.|              ::.|   :|......:.|||....:
Human   164 EYLVGEEALYVNPLDCYNIHWPIRRGQLNIHPGPGGSLTAVLAD---IEVIWSHAIQKYLEIPLK 225

  Fly   107 D-HYF--LLTEPPLNTPENREYTAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVV 168
            | .|:  :|..|.:...::.:....::.......|:.:..::|.|...|..|.:.        :|
Human   226 DLKYYRCILLIPDIYNKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTC--------IV 282

  Fly   169 DSGDGVTHVIPVAEGYVIGSCIKH------IPIAGRNITSFIQSLLREREVGIPPEQSLETAKA- 226
            |.||..|.|..|.:|      :.|      :...|.:::.....|:  :..|.|..:...|.|. 
Human   283 DVGDQKTSVCCVEDG------VSHRNTRLCLAYGGSDVSRCFYWLM--QRAGFPYRECQLTNKMD 339

  Fly   227 ------IKEKHCYICPDIA----KEFAKYDTEPGKWIRNF------------------------- 256
                  :||..|::..||:    .||.....:....:..|                         
Human   340 CLLLQHLKETFCHLDQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQK 404

  Fly   257 ------------------------------SGVNTVTKAPFNVDVGYERFLG------PEIFFHP 285
                                          |...|..:...:..:|:|..|.      ||.....
Human   405 MTTLQHRSQGDPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQ 469

  Fly   286 EF---------------SNPDFT----------------IPLSEIVDNVIQNCPI-DVRRPLYNN 318
            |.               |....|                :.|.:.:.:.|..|.. |.::.:|::
Human   470 EVDLGSAQGDGLMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSS 534

  Fly   319 IVLSGGSTMFKDFGRRLQ-RDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGS 382
            |::.||..||......|| |.:.:...:..||.||: :...:||.:|.::|        .|.||:
Human   535 ILVVGGGLMFHKAQEFLQHRILNKMPPSFRRIIENV-DVITRPKDMDPRLI--------AWKGGA 590

  Fly   383 MLASTPEFYQVCHTKAAYEEYGPSICRHNPVF 414
            :||......::...:..::.:|..:.|....|
Human   591 VLACLDTTQELWIYQREWQRFGVRMLRERAAF 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 84/487 (17%)
ACTR8NP_075050.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
NBD_sugar-kinase_HSP70_actin 162..619 CDD:388382 83/482 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..462 5/31 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.