DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and ACTL6A

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_004292.1 Gene:ACTL6A / 86 HGNCID:24124 Length:429 Species:Homo sapiens


Alignment Length:462 Identity:123/462 - (26%)
Similarity:200/462 - (43%) Gaps:118/462 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAI--------------KESARVG------DTNTRRI 51
            |.|.|:|:...:.|:||...|:...|:||.:              .:..:.|      |||..|:
Human    13 ALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRV 77

  Fly    52 TKGIEDLDFFIGDEAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPP 116
            .:           |..:|..     |:::|:|||||..:..|:.....::::|...|..|::|.|
Human    78 PR-----------ENMEAIS-----PLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAP 126

  Fly   117 LNTPENREYTAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVA 181
            .||...||...|:|||.:|:|..::...|||...|:..|        ||:::|||...|..|||.
Human   127 WNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRS--------TGLILDSGATHTTAIPVH 183

  Fly   182 EGYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAI----------KEK------ 230
            :|||:...|...|:||..||...:.|.:|..:.:.|...:.:.:|:          |||      
Human   184 DGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTR 248

  Fly   231 --HCYICPDIAKEF---------AKYDTEPGKWIRNFSGVNTVTKAP---------FNVDVGYER 275
              |.|:|..:.::|         :.||.:            ...:.|         :|.|.|.||
Human   249 SWHNYMCNCVIQDFQASVLQVSDSTYDEQ------------VAAQMPTVHYEFPNGYNCDFGAER 301

  Fly   276 FLGPEIFFHPEFSN-----PDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRL 335
            ...||..|.|  ||     .:..:.:|.:|...:..|.||:|..||.:::::||:|:.:.|..||
Human   302 LKIPEGLFDP--SNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRL 364

  Fly   336 QRDIKRSVDTRLR---ISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTK 397
            .|::.:.....:|   |:.|.:..|                |::.|.|||:|||...|.|:..:|
Human   365 NRELSQKTPPSMRLKLIANNTTVER----------------RFSSWIGGSILASLGTFQQMWISK 413

  Fly   398 AAYEEYG 404
            ..|||.|
Human   414 QEYEEGG 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 123/462 (27%)
ACTL6ANP_004292.1 Actin 11..429 CDD:394979 123/462 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.