DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and ACT7

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_196543.1 Gene:ACT7 / 830841 AraportID:AT5G09810 Length:377 Species:Arabidopsis thaliana


Alignment Length:410 Identity:153/410 - (37%)
Similarity:215/410 - (52%) Gaps:47/410 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATG-Y 72
            |.|.|||..|.||||:..|:.:.||.        ||......:..|:...|.::||||....| .
plant    11 VCDNGTGMVKAGFAGDDAPRAVFPSI--------VGRPRHTGVMVGMGQKDAYVGDEAQSKRGIL 67

  Fly    73 SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNVP 137
            ::|||:.||:|.:||.||:......:..||..||:|..||||.|||...|||...:|||||||||
plant    68 TLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVP 132

  Fly   138 GLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITS 202
            .:|:|:||||:|.||       .|| ||||:||||||:|.:|:.|||.:...|..:.:|||::|.
plant   133 AMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 189

  Fly   203 FIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKAPF 267
            .:..:|.||..........|..:.||||..|:..|..:|.        :..::.|.|....:.|.
plant   190 SLMKILTERGYMFTTTAEREIVRDIKEKLAYVALDYEQEL--------ETAKSSSSVEKNYELPD 246

  Fly   268 N--VDVGYERFLGPEIFFHPEFSNPDFTIP-LSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFK 329
            .  :.:|.|||..||:.|.|.....:  .| :.|...|.|..|.:|:|:.||.|||||||||||.
plant   247 GQVITIGAERFRCPEVLFQPSLIGME--APGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFP 309

  Fly   330 DFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVC 394
            ....|:.::|.                .:.|..:.::|:....::|:||.|||:|||...|.|:.
plant   310 GIADRMSKEIT----------------ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMW 358

  Fly   395 HTKAAYEEYGPSICRHNPVF 414
            .:|:.|:|.||||. |...|
plant   359 ISKSEYDESGPSIV-HRKCF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 153/410 (37%)
ACT7NP_196543.1 NBD_sugar-kinase_HSP70_actin 5..377 CDD:418402 152/408 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.