DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and ARP7

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_567105.1 Gene:ARP7 / 825254 AraportID:AT3G60830 Length:363 Species:Arabidopsis thaliana


Alignment Length:435 Identity:126/435 - (28%)
Similarity:178/435 - (40%) Gaps:97/435 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPACVIDVGTGYSKLGFA-GNKEPQFIIPSAIAIKESARVGDTNTRRITKGIED--LDFFIGDEA 66
            :.|.|:|.|:.:.|.|.| .::.|..||||  .:|.....|.::....|...||  ||       
plant     1 MEALVVDAGSKFLKAGAAIPDQSPAMIIPS--QMKRMVDDGSSSADNPTTVFEDVTLD------- 56

  Fly    67 FDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPEN-REYTAEIM 130
                      |:..||:.|||.||..|...|:..|..|..:...:|...||.||:. ||...::|
plant    57 ----------PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQLVQLM 111

  Fly   131 FETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPI 195
            ||||||.|.|.:.||||:|.|  ..|      ::|..||.|.|...:.||.||.|.....|...:
plant   112 FETFNVSGFYASEQAVLSLYA--VGR------ISGCTVDIGHGKIDIAPVLEGAVQHIASKRFEL 168

  Fly   196 AGRNITS-FIQSLLREREVGIPPEQ--SLETAKAIKEKHCYICPDIAKEFAKYDTE--------- 248
            .|..:|. |.|.|.:..     |..  |:...:.:||::.....|   |.|...|:         
plant   169 GGTELTKLFAQELGKTN-----PSMNLSMSDVEKLKEQYANCAED---EIAYKKTQNCEIEQHTL 225

  Fly   249 PGKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSE--IVD---NVIQNCP 308
            |...:               :.:|.||:...|..|.|..      :.|.|  ||:   .:|....
plant   226 PDGQV---------------ISIGRERYSVGEALFQPSI------LGLEEHGIVEQLVRIISTVS 269

  Fly   309 IDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKP---KPIDVQVITH 370
            .:..|.|..|.||.||:|....|..|.|::            .||....|:|   ||  .:.:..
plant   270 SENHRQLLENTVLCGGTTSMTGFESRFQKE------------ANLCSSAIRPTLVKP--PEYMPE 320

  Fly   371 HMQRYAVWFGGSMLASTPEFYQVCH-TKAAYEEYGPSICRHNPVF 414
            ::..|:.|.||::||.. .|.|..| |||.|:|.|||:. |...|
plant   321 NLGMYSAWVGGAILAKV-VFPQNQHVTKADYDETGPSVV-HRKCF 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 126/435 (29%)
ARP7NP_567105.1 ACTIN 3..363 CDD:214592 125/431 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.