DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and AT2G42170

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001323727.1 Gene:AT2G42170 / 818817 AraportID:AT2G42170 Length:329 Species:Arabidopsis thaliana


Alignment Length:364 Identity:131/364 - (35%)
Similarity:195/364 - (53%) Gaps:40/364 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GIEDLDFFIGDEAFDATG-YSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPL 117
            |:.:.|.|:||:|...:| .::.||:.||:|.:||.||:......:..||..||:|..||||.||
plant     3 GMNENDLFVGDDAEARSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPVLLTEAPL 67

  Fly   118 NTPENREYTAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAE 182
            |...:||...:||||||.||.:||.:||.|:|.||       .|| ||.|:||||||::::|:.|
plant    68 NPKADREKMTQIMFETFAVPSMYIGMQAALSLHAS-------GRT-TGTVLDSGDGVSYIVPIYE 124

  Fly   183 GYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDT 247
            |..:...|..:.:|||::|:::..::.||  |....:. |..:.|||:..||..|..:|..|   
plant   125 GSALPHAILRLDLAGRHLTNYLMKIMMER--GYTSAER-EVVRDIKEQFGYIALDYEQEMEK--- 183

  Fly   248 EPGKWIRNFSGVNTVTKAPFN--VDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPID 310
                 ....|.::...:.|..  :.:|.|||..||:.|.|.....: |..:.|...|.|..|..|
plant   184 -----ATKSSAIDRTYELPDGQVITIGAERFRCPEVLFQPSLIGME-TSGIHEKTYNSIMKCDDD 242

  Fly   311 VRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRY 375
            :|:.||.|||||||:|||:....|:.::|.......:||                :::....::|
plant   243 IRKDLYGNIVLSGGTTMFRGIEERMTKEINALAAANMRI----------------KIVAPPERKY 291

  Fly   376 AVWFGGSMLASTPEFYQVCHTKAAYEEYGPSICRHNPVF 414
            :||.|||:|||...:.|:..|||.|||.||:|. |...|
plant   292 SVWIGGSILASLSTYEQMWITKAEYEENGPAIV-HTKCF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 131/364 (36%)
AT2G42170NP_001323727.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.