DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and ACT9

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_181739.1 Gene:ACT9 / 818809 AraportID:AT2G42090 Length:366 Species:Arabidopsis thaliana


Alignment Length:410 Identity:130/410 - (31%)
Similarity:204/410 - (49%) Gaps:65/410 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATGY- 72
            |.|.|.|..:.||||::.|:.:.|..:.             |...|:...:.::|:|     |: 
plant     5 VCDKGHGMVQAGFAGDEAPKVVFPCVVG-------------RPRDGLNPNESYVGEE-----GHA 51

  Fly    73 -----SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132
                 ::|.|:.||:|.:||.||:......:..||.:||:|..||||.|.|...|||...:||||
plant    52 NRDILTLKDPMEHGIVNNWDDMEKIWHYTFYNELRVDPEEHPVLLTEAPYNPKANREKMTQIMFE 116

  Fly   133 TFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAG 197
            :|:||.:|:::|:||.|.:|       .|| ||:|:|.|:.|:|.:||.|||.:...|..:.:.|
plant   117 SFDVPAMYVSMQSVLYLYSS-------GRT-TGVVLDLGERVSHTVPVYEGYALPHGILRLDLGG 173

  Fly   198 RNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTV 262
            |::|.::..::.||..........|..:.||||.||:..|..:|..|  |..| |        |:
plant   174 RDLTDYLIEIMTERGYTYTTSAEREIVRDIKEKLCYVALDYEQEMEK--TTKG-W--------TI 227

  Fly   263 TKAPF-----NVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLS 322
            .|...     .:.:..|||:.||:.|.|.....: :..:.|...|.|..||:|.||.:|.||:::
plant   228 DKTYVLPDGQEITIEAERFMCPEVLFQPSVIGKE-SSGIHEATRNSILKCPVDTRRDMYGNILMT 291

  Fly   323 GGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLAST 387
            ||:||......|:.:::...|                |..:.|:|:.......:||.|||:|||.
plant   292 GGTTMLHGIKERMTKELNALV----------------PSSMKVKVVVPPESECSVWIGGSILASL 340

  Fly   388 PEFYQVCHTKAAYEEYGPSI 407
            ..|:|:..||..|||:|.:|
plant   341 STFHQMWITKDEYEEHGAAI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 130/410 (32%)
ACT9NP_181739.1 ACTIN 2..365 CDD:214592 130/410 (32%)
NBD_sugar-kinase_HSP70_actin 1..365 CDD:302596 130/410 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.