DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actrt3

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_083966.1 Gene:Actrt3 / 76652 MGIID:1923902 Length:369 Species:Mus musculus


Alignment Length:417 Identity:128/417 - (30%)
Similarity:197/417 - (47%) Gaps:64/417 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDE 65
            |:|..|..|||.|:|..|.|.||.:||||:.|:.:. :......|:..          :..:||:
Mouse     1 MSGYQPPVVIDNGSGMIKAGLAGTREPQFVYPNILG-RSKGHTADSRQ----------ELCVGDQ 54

  Fly    66 AFDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKY-LRAEPEDHYFLLTEPPLNTPENREYTAE 128
            |.:...: ||.|||..||:..|..|| .:.:.::.| |.....|...|:|||.||...:|::.:|
Mouse    55 AQERRSFLSISYPVERGLISSWGDME-IMWKHIYDYNLNLNASDGPVLVTEPALNPLADRQHISE 118

  Fly   129 IMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHI 193
            :.||...||..|::.||||||.|:..:        ||:|::||.|:|..:|:.|||.:...:|.:
Mouse   119 VFFENLGVPAFYMSAQAVLALFAAGFT--------TGLVLNSGAGITQCVPIFEGYCLSHGVKQL 175

  Fly   194 PIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAK-------YDTEPGK 251
            .:||.::||::..||:...:.:......:....|||..||:..:...|..|       |....||
Mouse   176 NVAGSDLTSYLMMLLKGDGIMLLRTGDRKVVTDIKENACYVAMNYEDEMTKDSNLEKIYTLPDGK 240

  Fly   252 WIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIP-LSEIVDNVIQNCPIDVRRPL 315
                            .|.:..:.|..||..|.|...|.|  .| :.::....|..|..|:|...
Mouse   241 ----------------TVKLHKQLFHCPEALFSPYLVNVD--APGIDKMCFGSIMKCDTDLRNSF 287

  Fly   316 YNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFG 380
            ::||:||||||.|....:||.:|:                .::.|....||||....::.:||.|
Mouse   288 FSNIILSGGSTSFPGLDKRLIKDV----------------AKLAPANTAVQVIAPPERKISVWMG 336

  Fly   381 GSMLASTPEFYQVCHTKAAYEEYGPSI 407
            ||:|||...|..:..|.|.:||.||:|
Mouse   337 GSILASLSAFQDMWITAAEFEEVGPNI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 127/416 (31%)
Actrt3NP_083966.1 ACTIN 5..369 CDD:214592 126/413 (31%)
NBD_sugar-kinase_HSP70_actin 9..369 CDD:302596 125/409 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.