DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actrt1

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_082790.1 Gene:Actrt1 / 73360 MGIID:1920610 Length:376 Species:Mus musculus


Alignment Length:412 Identity:140/412 - (33%)
Similarity:202/412 - (49%) Gaps:67/412 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKE----SARVGDTNTRRITKGIEDLDFFIGDEA 66
            ||.:.|.|:|..|:|.:|..||:.:|.|.:...:    |||   :|.:|         :|:|:||
Mouse    10 PAVIFDNGSGLCKVGISGEIEPRHVINSVVGHPKFNIPSAR---SNRKR---------YFVGEEA 62

  Fly    67 ---FDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAE 128
               :|  |..:.||:..|||..||.||:..:......|..:|.:....:|||.||..|.||.|.|
Mouse    63 QCMYD--GLYLHYPIERGLVTRWDDMEKLWKDLFEWELGVKPNEQPVFMTEPSLNPQETREKTTE 125

  Fly   129 IMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHI 193
            ||||.||||.||:...||.||.||        ..:||:|:|||||||..:||.|||.:...|..:
Mouse   126 IMFEKFNVPALYLCNHAVGALCAS--------ACITGLVLDSGDGVTCTVPVYEGYSLPHAITKL 182

  Fly   194 PIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPG--KWIRNF 256
            .:|||:||..:..||..:....|...:......||||.|.:      .....|||..  :::|.:
Mouse   183 YVAGRDITEHLTRLLLAKGYTFPCILNKAVVDDIKEKLCTV------SLGYKDTEKNCQQFLRKY 241

  Fly   257 S--GVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNI 319
            :  ..||:..:.....|       ||:.|.|:... ...:.:|::|.|.|.||..|::..|:..|
Mouse   242 TLPDGNTIQMSDHLCQV-------PEVLFTPDHLG-IHDLGISKMVCNSIMNCDTDIQENLFAEI 298

  Fly   320 VLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLS-EGRIKPKPIDVQVITHHMQR-YAVWFGGS 382
            |||||:|||.....||.:::           |:|: ||    .||.   ||....| |:.|.|||
Mouse   299 VLSGGTTMFPGLQDRLLKEL-----------EDLAFEG----TPIK---ITASSDRCYSAWIGGS 345

  Fly   383 MLASTPEFYQVCHTKAAYEEYG 404
            ::.|...|.|:..|...::|||
Mouse   346 VMTSMTTFKQMWVTAEDFKEYG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 140/412 (34%)
Actrt1NP_082790.1 NBD_sugar-kinase_HSP70_actin 8..376 CDD:302596 140/412 (34%)
ACTIN 9..376 CDD:214592 140/412 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.