DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Potef

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002728578.2 Gene:Potef / 684969 RGDID:1584390 Length:414 Species:Rattus norvegicus


Alignment Length:425 Identity:155/425 - (36%)
Similarity:217/425 - (51%) Gaps:61/425 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDE 65
            |...:.|.|||.|:|..|.||||:..|:.:.||.        ||....:.:..|:...|.::|||
  Rat    40 MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDE 96

  Fly    66 AFDATG-YSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEI 129
            |....| .::|||..||:|.:||.||:......:..||..||:|..||||.|||...|||...:|
  Rat    97 AQSKRGILTLKYPNEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 161

  Fly   130 MFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIP 194
            ||||||.|.:|:|:||||:|.||       .|| ||||:||||||||.:|:.|||.:...|..:.
  Rat   162 MFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVMDSGDGVTHTVPIYEGYALPHAILRLD 218

  Fly   195 IAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFA----------KYDTEP 249
            :|||::|.::..:|.||..........|..:.||||.||:..|..:|.|          .|:...
  Rat   219 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPD 283

  Fly   250 GKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRP 314
            |:.|                .:|.|||..||..|.|.|...: :..:.|...|.|..|.:|:|:.
  Rat   284 GQVI----------------TIGNERFRCPEALFQPSFLGME-SCGIHETTFNSIMKCDVDIRKD 331

  Fly   315 LYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWF 379
            ||.|.|||||:||:.....|:|::|.                .:.|..:.:::|....::|:||.
  Rat   332 LYANTVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWI 380

  Fly   380 GGSMLASTPEFYQVCHTKAAYEEYGPSICRHNPVF 414
            |||:|||...|.|:..:|..|:|.||||. |...|
  Rat   381 GGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 154/424 (36%)
PotefXP_002728578.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.