DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actr2

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001349828.1 Gene:Actr2 / 66713 MGIID:1913963 Length:399 Species:Mus musculus


Alignment Length:422 Identity:141/422 - (33%)
Similarity:213/422 - (50%) Gaps:70/422 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIDVGTGYSKLGFAGNKEPQFIIPSAIA---IKESARVGDTNTRRITKGIEDLDFFIGDEAFDAT 70
            |.|.|||:.|.|:||:..|:.|.|:.:.   |:.:.:||:...:...|    :|..:||||.:..
Mouse    10 VCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKNNKK----MDLMVGDEASELR 70

  Fly    71 G-YSIKYPVRHGLVEDWDLMERFLEQCVF--KYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132
            . ..:.||:.:|:|.:||.| :.|....|  :.|..:..:...||||||:|..:|||...|:|||
Mouse    71 SMLEVNYPMENGIVRNWDDM-KHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFE 134

  Fly   133 TFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAG 197
            |:...|:|:|:||||.|.|        :..|||:||||||||||:.||.||:.:....:.:.|||
Mouse   135 TYQFSGVYVAIQAVLTLYA--------QGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAG 191

  Fly   198 RNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKE----------FAKYDTEPGKW 252
            |:||.::..||..|..........||.:.||||.||:..:|.:|          ...|....|:.
Mouse   192 RDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRI 256

  Fly   253 IRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYN 317
            |:                ||.|||..||..|.|...|.: .:.::|::.|.||...||.|...|.
Mouse   257 IK----------------VGGERFEAPEALFQPHLINVE-GVGVAELLFNTIQAADIDTRSEFYK 304

  Fly   318 NIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRIS--ENLSEGRIK----PKPIDVQVITHHMQRYA 376
            :|||||||||:.....||:|::|:....|:...  |.||:.:|:    |:           :::.
Mouse   305 HIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR-----------RKHM 358

  Fly   377 VWFGGSMLA----STPEFYQVCHTKAAYEEYG 404
            |:.||::||    ....|:.   |:..|:|.|
Mouse   359 VFLGGAVLADIMKDKDNFWM---TRQEYQEKG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 141/422 (33%)
Actr2NP_001349828.1 ACTIN 6..393 CDD:214592 141/422 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.