DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and ACTR3C

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_016868037.1 Gene:ACTR3C / 653857 HGNCID:37282 Length:280 Species:Homo sapiens


Alignment Length:302 Identity:178/302 - (58%)
Similarity:207/302 - (68%) Gaps:43/302 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 MFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIP 194
            |||:||||||||||||||||||||.||...||||||||:||||||||||||||||||||||||||
Human     1 MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIP 65

  Fly   195 IAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGV 259
            ||||:||.|||.||||||||||||||||||||||||:|||||||.|||||||.:|.|||:.::|:
Human    66 IAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPQKWIKQYTGI 130

  Fly   260 NTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNI-VLSG 323
            |.:.:..|.:||||||||||||||||||:|||....:|::||.||||||||||||||..: ||.|
Human   131 NAINQKKFVIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPIDVRRPLYKVLGVLPG 195

  Fly   324 GSTMFKDFGRRLQRDIKRSVDTRLRI----------SENLSEGRIKPKPIDVQVITHHMQRYAVW 378
               .::|...|......:::...|..          ::.||..||.|.      :...:||    
Human   196 ---RYRDHPMRYGSGSWQNLLCHLPTIPGRFGGWSPAQELSGLRILPP------LHRSLQR---- 247

  Fly   379 FGGSMLASTPEFYQVCHTKAAYEEYGPS--------ICRHNP 412
             |||..| .|:       .||  |.||:        :|||.|
Human   248 -GGSPRA-RPD-------SAA--EGGPTSRLPRGAHLCRHPP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 178/302 (59%)
ACTR3CXP_016868037.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.