DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actr10

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_062759.2 Gene:Actr10 / 56444 MGIID:1891654 Length:417 Species:Mus musculus


Alignment Length:445 Identity:111/445 - (24%)
Similarity:188/445 - (42%) Gaps:97/445 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAF 67
            |...|.|||:|..::|.||||...|:.||||.|     .|.|      ::|.|:.:.:.|..|  
Mouse    11 GEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI-----KRAG------MSKPIKVVQYNINTE-- 62

  Fly    68 DATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132
                            |.:..::.|:....|::|...|.|...::.|..|.....||....::|:
Mouse    63 ----------------ELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFK 111

  Fly   133 TFNVPGLYIAVQAVLALAASWASRSAEERTL---TGIVVDSGDGVTHVIPVAEGYVIGSCIKHIP 194
            .|.||.:.:|...::||.           ||   :.:|:|.|...:.|:|:.||..|.:|...:|
Mouse   112 YFEVPSVLLAPSHLMALL-----------TLGINSAMVLDCGYRESLVLPIYEGIPILNCWGALP 165

  Fly   195 IAGRNITSFIQSLLRER---EVGIPPEQSLETA---------KAIKEKHCYICPDIAK----EFA 243
            :.|:.:...:::.|.|:   :.|....|||.:.         :.||.:.|:: .|:.:    :.|
Mouse   166 LGGKALHKELETQLLEQCTVDTGAAKGQSLPSVMGSVPEGVLEDIKVRTCFV-SDLKRGLQIQAA 229

  Fly   244 KYDTEPGKWIRNFSGVNTVTKAPFNVD-----------VGYERFLGPEIFFHPEFSNPDFTIPLS 297
            |:         |..|.|.....|.|||           :|..|....||.|  |..|.:.:: .:
Mouse   230 KF---------NIDGNNERPTPPPNVDYPLDGEKILHVLGSIRDSVVEILF--EQDNEEKSV-AT 282

  Fly   298 EIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVD-TRLRISENLSEGRIKPK 361
            .|:|:::| ||||.|:.|..|:|:.||::|...|..||..:|:..|: .:.:.:......||...
Mouse   283 LILDSLLQ-CPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKNFRIHTP 346

  Fly   362 PIDVQVITHHMQRYAVWFGGSMLASTPEFY-QVCHTKAAYEEYG--PSICR-HNP 412
            |.....:        .|.||::..:..:.. ....:|..|.:.|  |..|. :||
Mouse   347 PAKANCV--------AWLGGAVFGALQDILGSRSISKEYYNQTGRIPDWCSLNNP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 111/445 (25%)
Actr10NP_062759.2 Actin 13..364 CDD:330363 103/412 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.