DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actr8

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_006519372.2 Gene:Actr8 / 56249 MGIID:1860775 Length:686 Species:Mus musculus


Alignment Length:278 Identity:54/278 - (19%)
Similarity:99/278 - (35%) Gaps:77/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TNTRRITKGIEDLDFFIGDEAFDATG---YSIKYPVRHG--------------LVEDWDLMERFL 93
            |||.      :..::.:|:||.....   |:|.:|:|.|              ::.|   :|...
Mouse   157 TNTS------QQPEYLVGEEALYVNPLDCYNIHWPIRRGQLNIHPGPGGSLTAVLAD---IEVIW 212

  Fly    94 EQCVFKYLRAEPED-HYF--LLTEPPLNTPENREYTAEIMFETFNVPGLYIAVQAVLALAASWAS 155
            ...:.|||....:| .|:  :|..|.:...::.:....::.......|:.:..::|.|...|..|
Mouse   213 SHAIQKYLEIPLKDLKYYRCILLIPDIYNKQHVKELVHMILMKMGFAGIVVHQESVCATFGSGLS 277

  Fly   156 RSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKH------IPIAGRNITSFIQSLLREREVG 214
            .:.        |||.||..|.|..|.:|      :.|      :...|.:::.....|:  :..|
Mouse   278 STC--------VVDVGDQKTSVCCVEDG------VSHRNTRLCLAYGGSDVSRCFYWLM--QRAG 326

  Fly   215 IPPEQSLETAKA-------IKEKHCYICPDIA----KEF-AKYDTEPGKWIRNFSGVNTVTKAPF 267
            .|..:...|.|.       :||..|::..||:    .|| .::...|.              ..:
Mouse   327 FPYRECQLTNKMDCLLLQHLKETFCHLDQDISGLQDHEFQIRHPDSPA--------------LLY 377

  Fly   268 NVDVGYERFLGPEIFFHP 285
            ...:|.|:...|...|:|
Mouse   378 QFRLGDEKLQAPMALFYP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 54/278 (19%)
Actr8XP_006519372.2 NBD_sugar-kinase_HSP70_actin 160..>400 CDD:388382 51/275 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.