DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and ACTR10

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_011535262.1 Gene:ACTR10 / 55860 HGNCID:17372 Length:424 Species:Homo sapiens


Alignment Length:455 Identity:111/455 - (24%)
Similarity:189/455 - (41%) Gaps:110/455 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAF 67
            |...|.|||:|..::|.||||...|:.||||.|     .|.|      :.|.:..:.:.|..|  
Human    11 GEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI-----KRAG------MPKPVRVVQYNINTE-- 62

  Fly    68 DATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132
                            |.:..::.|:....|::|...|.|...::.|..|.....||....::|:
Human    63 ----------------ELYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFK 111

  Fly   133 TFNVPGLYIAVQAVLALAASWASRSAEERTL---TGIVVDSGDGVTHVIPVAEGYVIGSCIKHIP 194
            .|.||.:.:|...::||.           ||   :.:|:|.|...:.|:|:.||..:.:|...:|
Human   112 YFEVPSVLLAPSHLMALL-----------TLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALP 165

  Fly   195 IAGRNITSFIQSLLRE---------REVGIP------PEQSLETAKA----IKEKHCYICPDIAK 240
            :.|:.:...:::.|.|         :|..:|      ||..||..|.    :|.:.|:: .|:.:
Human   166 LGGKALHKELETQLLEQCTVDTSVAKEQSLPSVMGSVPEGVLEDIKGLLFFLKARTCFV-SDLKR 229

  Fly   241 ----EFAKYDTEPGKWIRNFSGVNTVTKAPFNVDVGYE-----RFLGP------EIFFHPEFSNP 290
                :.||:         |..|.|.....|.|||...:     ..||.      ||.|  |..|.
Human   230 GLKIQAAKF---------NIDGNNERPSPPPNVDYPLDGEKILHILGSIRDSVVEILF--EQDNE 283

  Fly   291 DFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVD-TRLRISENLS 354
            :.:: .:.|:|::|| ||||.|:.|..|:|:.||::|...|..||..:|:..|: .:.:.:....
Human   284 EQSV-ATLILDSLIQ-CPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTK 346

  Fly   355 EGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAYEEYG------PSICR-HNP 412
            ..||...|.....:        .|.||::..:..:   :..:::..:||.      |..|. :||
Human   347 TFRIHTPPAKANCV--------AWLGGAIFGALQD---ILGSRSVSKEYYNQTGRIPDWCSLNNP 400

  Fly   413  412
            Human   401  400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 111/455 (24%)
ACTR10XP_011535262.1 NBD_sugar-kinase_HSP70_actin 12..389 CDD:302596 106/441 (24%)
Actin 14..395 CDD:278451 107/445 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.