DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and actr6

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001016472.1 Gene:actr6 / 549226 XenbaseID:XB-GENE-5860964 Length:396 Species:Xenopus tropicalis


Alignment Length:437 Identity:113/437 - (25%)
Similarity:183/437 - (41%) Gaps:88/437 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATGYS 73
            |:|.|...:|:|::..:..  :||:.....::||:......:|            ||..|.:|..
 Frog     5 VLDNGAYNAKIGYSHGQVS--VIPNCQFRTKTARLKTFTANQI------------DEIKDPSGLF 55

  Fly    74 IKYPVRHGLVEDWDLMERFLEQCVFKYL------RAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132
            ...|.:.|.:.:||:..:     |:.||      :.:..|...::|||..|....:|...||:||
 Frog    56 YILPYQKGYLVNWDVQRQ-----VWDYLFGKEMFQVDFPDSNIIITEPYFNFSSIQESMNEILFE 115

  Fly   133 TFNVPGLYIAVQAVLALAASWASRSAEER----TLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHI 193
            .:.       .||.|.:.|...|.....|    .|..|:||||...||::|..........|..|
 Frog   116 EYQ-------FQAALRINAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPFCRSKKKKEGIIRI 173

  Fly   194 PIAGRNITSFIQSLLREREVGIPPE-------------------QSLETAKAIKEKHC----YIC 235
            .:.|:.:|:.::.::..|::.:..|                   :.:||||...|::.    |:.
 Frog   174 NVGGKLMTNHLKEIISYRQLQVMDETHVINQVKEDVCYVSTDFYKDMETAKLKGEENSVMVDYVL 238

  Fly   236 PD---IAKEFAKYDTEPGKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHP-EFSNPDFTIPL 296
            ||   |.|.|.|...|     ..|||..|..:....:.  .|||..|||.||| :....:..|| 
 Frog   239 PDFSTIKKGFCKPREE-----MVFSGKTTAGEQILRLT--NERFAVPEILFHPSDIGIQEMGIP- 295

  Fly   297 SEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPK 361
             |.:.:.|.|.|.:::...|.||||:||:|:|..|..|:..::::...|...:|..|.|..|.  
 Frog   296 -EAIVHSINNLPEEMQPHFYKNIVLTGGNTLFPGFRERVFSEVRKLTPTDFDVSVILPENPIS-- 357

  Fly   362 PIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAYEEYGPSIC 408
                         || |.||.:::...:|..:..|:..|||.|..||
 Frog   358 -------------YA-WEGGKIISENDDFEDMVVTREDYEENGHIIC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 113/437 (26%)
actr6NP_001016472.1 ACTIN 2..394 CDD:214592 113/437 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.