DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actr1a

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_058556.1 Gene:Actr1a / 54130 MGIID:1858964 Length:376 Species:Mus musculus


Alignment Length:404 Identity:149/404 - (36%)
Similarity:219/404 - (54%) Gaps:57/404 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATG-Y 72
            |||.|:|..|.||||::.|::..|:        .||.....|:..|..:.|.|||.:|.:..| .
Mouse    13 VIDNGSGVIKAGFAGDQIPKYCFPN--------YVGRPKHVRVMAGALEGDIFIGPKAEEHRGLL 69

  Fly    73 SIKYPVRHGLVEDWDLMERFLEQCVFK-YLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNV 136
            ||:||:.||:|:||:.|||..:....| .|:...|:|..||||.|||..:|||..||:.||||||
Mouse    70 SIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNV 134

  Fly   137 PGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNIT 201
            |.|:|::||||:|.|:       .|| ||:|:||||||||.:|:.||:.:...|..|.||||:::
Mouse   135 PALFISMQAVLSLYAT-------GRT-TGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVS 191

  Fly   202 SFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAK------EFAKYDTEPGKWIRNFSGVN 260
            .|::..||:...........|..|||||:.||:..:..|      |.|:|....|.         
Mouse   192 RFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGS--------- 247

  Fly   261 TVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGS 325
                   .:::|..||..||:.|.|:....: :..:.|::...||...:|:||.|::||||||||
Mouse   248 -------TIEIGPSRFRAPELLFRPDLIGEE-SEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGS 304

  Fly   326 TMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEF 390
            |:||.||.||..::|                ::.||.:.:::.....:.|:.|.|||:|||...|
Mouse   305 TLFKGFGDRLLSEVK----------------KLAPKDVKIRISAPQERLYSTWIGGSILASLDTF 353

  Fly   391 YQVCHTKAAYEEYG 404
            .::..:|..|||.|
Mouse   354 KKMWVSKKEYEEDG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 149/404 (37%)
Actr1aNP_058556.1 NBD_sugar-kinase_HSP70_actin 5..376 CDD:418402 149/404 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.