DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and actr1b

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_998537.1 Gene:actr1b / 406681 ZFINID:ZDB-GENE-040426-2695 Length:376 Species:Danio rerio


Alignment Length:402 Identity:145/402 - (36%)
Similarity:217/402 - (53%) Gaps:57/402 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATG-Y 72
            |||.|:|..|.||||::.|::..|:        .||.....|:..|..:.|.|||.:|.:..| .
Zfish    13 VIDNGSGVIKAGFAGDQIPKYCFPN--------YVGRPKHVRVMAGALEGDLFIGPKAEEHRGLL 69

  Fly    73 SIKYPVRHGLVEDWDLMERFLEQCVFK-YLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNV 136
            |::||:.||:|:||:.|||..:....| .|:...|:|..||||.|||..:|||..||:.||||||
Zfish    70 SVRYPMEHGIVKDWNDMERIWQYVYSKEQLQTFSEEHPVLLTEAPLNPSKNRERAAEVFFETFNV 134

  Fly   137 PGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNIT 201
            |.|:|::||||:|.|:       .|| ||:|:|:||||||.:|:.||:.|...|..:.||||:::
Zfish   135 PALFISMQAVLSLYAT-------GRT-TGVVLDAGDGVTHAVPIYEGFAIPHSIMRVDIAGRDVS 191

  Fly   202 SFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAK------EFAKYDTEPGKWIRNFSGVN 260
            .:::.|||:...........|..:.|||:.||:..:..|      |.|:|....|.         
Zfish   192 RYLRLLLRKEGYDFHTSAEFEVVRTIKERACYLSLNPQKDETLETEKAQYTLPDGS--------- 247

  Fly   261 TVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGS 325
                   .:|:|..||..||:.|.|:... |.:..:.|::...||...:|:||.|::||||||||
Zfish   248 -------TLDIGPARFRAPELLFRPDLIG-DESEGIHEVLAFAIQKSDMDLRRTLFSNIVLSGGS 304

  Fly   326 TMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEF 390
            |:.|.||.||..::|                ::.||.:.:::.....:.|:.|.|||:|||...|
Zfish   305 TLLKGFGDRLLSEVK----------------KLAPKDVKIKISAPQERLYSTWIGGSILASLDTF 353

  Fly   391 YQVCHTKAAYEE 402
            .::..:|..|||
Zfish   354 KKMWVSKKEYEE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 145/402 (36%)
actr1bNP_998537.1 NBD_sugar-kinase_HSP70_actin 5..376 CDD:418402 145/402 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.