DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Act79B

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster


Alignment Length:419 Identity:152/419 - (36%)
Similarity:215/419 - (51%) Gaps:61/419 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATG 71
            |.|:|.|:|..|.||||:..|:.:.||.        ||....:.:..|:...|.::||||....|
  Fly     8 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDCYVGDEAQSKRG 64

  Fly    72 -YSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFN 135
             .|:|||:.||::.:||.||:......:..||..||:|..||||.|||...|||...:|||||||
  Fly    65 ILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 129

  Fly   136 VPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNI 200
            .|.:|:|:||||:|.||       .|| ||||:||||||:|.:|:.|||.:...|..:.:|||::
  Fly   130 SPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 186

  Fly   201 TSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFA----------KYDTEPGKWIRN 255
            |.::..:|.||..........|..:.||||.||:..|..:|.|          .|:...|:.|  
  Fly   187 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVI-- 249

  Fly   256 FSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIV 320
                          .:|.|||..||..|.|.|...: :..:.|.|...|..|.:|:|:.||.|.|
  Fly   250 --------------TIGNERFRTPEALFQPSFLGME-SCGIHETVYQSIMKCDVDIRKDLYANNV 299

  Fly   321 LSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLA 385
            ||||:||:.....|:|::|.                .:.|..|.:::|....::|:||.|||:||
  Fly   300 LSGGTTMYPGIADRMQKEIT----------------ALAPSTIKIKIIAPPERKYSVWIGGSILA 348

  Fly   386 STPEFYQVCHTKAAYEEYGPSICRHNPVF 414
            |...|.|:..:|..|:|.||.|. |...|
  Fly   349 SLSTFQQMWISKQEYDESGPGIV-HRKCF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 152/419 (36%)
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 151/417 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467750
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.