DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and actr10

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_956464.1 Gene:actr10 / 393139 ZFINID:ZDB-GENE-040426-768 Length:415 Species:Danio rerio


Alignment Length:425 Identity:103/425 - (24%)
Similarity:175/425 - (41%) Gaps:115/425 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAF 67
            |...|.|||:|..|:|.||||...|:|||||.|....|..|           :..:.|.|..|  
Zfish    11 GEKTAVVIDLGAAYTKCGFAGETGPRFIIPSEIKHPGSQEV-----------VAVVQFNINTE-- 62

  Fly    68 DATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132
                            |.:.:::.|:....|::|...|.|...::.|..|.....|:..:.::|.
Zfish    63 ----------------ELYTILKEFIHLLYFRHLLVNPRDRRVVVIESILCPSHYRDTLSRVLFR 111

  Fly   133 TFNVPGLYIAVQAVLALAASWASRSAEERTL---TGIVVDSGDGVTHVIPVAEGYVIGSCIKHIP 194
            .|.||.:..|...::::           .||   :.:|:|.|...|.|:|:.||..|.|..:.:|
Zfish   112 HFEVPSVLFAPSHLMSI-----------MTLGLQSALVMDCGYTETLVLPIYEGIPILSAWEALP 165

  Fly   195 IAGRNITSFIQSLLRER-------EVGIP--------PEQSLETAKAIKEKHCYICPDIAK---- 240
            :.|:.|...:||||.|:       ..|:.        ||..:|.   ||.:.|:: .|:.:    
Zfish   166 MGGKAIHKELQSLLSEQCTVDTDSSTGLQLPSVISHIPEDVVED---IKVRTCFV-SDLQRGLKI 226

  Fly   241 EFAKYDTEPGKWIRNFSGVNTVTKAPFNVDV-----------GYERFLGPEIFFHPEFSNPDFTI 294
            :.||::|:..:           ...|.:||.           |:.|....|:.|  |..|.:.:|
Zfish   227 QEAKFNTDAER-----------PAPPPDVDYPLDGQKILHVKGFIRDSVAEMLF--EQDNEEKSI 278

  Fly   295 PLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIK 359
             .:.::|.::: ||||.|:.|..|:::.||:.|...|..||..:|:..|:              |
Zfish   279 -ATLLLDTLVK-CPIDTRKVLSENLLIIGGTAMLPGFLHRLLAEIRSLVE--------------K 327

  Fly   360 PKPIDVQVITHHMQRYA--------VWFGGSMLAS 386
            ||..|. :.|...:.::        .|.||::..:
Zfish   328 PKYRDA-LATKSFRIHSPPAKPNCTAWLGGAIFGA 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 103/425 (24%)
actr10NP_956464.1 NBD_sugar-kinase_HSP70_actin 12..362 CDD:302596 102/424 (24%)
ACTIN 13..362 CDD:214592 102/423 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.