DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actrt3

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001102412.1 Gene:Actrt3 / 365763 RGDID:1561457 Length:371 Species:Rattus norvegicus


Alignment Length:418 Identity:130/418 - (31%)
Similarity:203/418 - (48%) Gaps:64/418 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIA-IKESARVGDTNTRRITKGIEDLDFFIGD 64
            |:...|..|||.|:|..|.|.||.:||||:.|:.:. .|..:...|:..          :..:||
  Rat     1 MSSYQPPVVIDNGSGMIKAGLAGAREPQFVYPNILGRTKNHSPAADSKQ----------ELRVGD 55

  Fly    65 EAFDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKY-LRAEPEDHYFLLTEPPLNTPENREYTA 127
            :|.:...: ||.|||..||:..|..|| .:.:.::.| |...|.|...|:|||.||...:|::.:
  Rat    56 QAQERRSFLSISYPVERGLISSWGDME-IMWKHIYDYNLNLNPSDGPVLVTEPALNPLADRQHIS 119

  Fly   128 EIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKH 192
            |:.||...||..|::|||||||.|:..:        ||:|::||.|:|..:|:.|||.:...:|.
  Rat   120 EVFFENLGVPAFYMSVQAVLALFAAGFT--------TGLVLNSGAGITQCVPIFEGYCLSHGVKQ 176

  Fly   193 IPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAK-------YDTEPG 250
            :.:||.::|:::..||::..:.:......:|...|||..||:..:..:|..|       |....|
  Rat   177 LNVAGIDLTNYLMMLLKDDGIMLLRTGDRKTVTDIKENACYVAMNYDEEMVKESNVEKMYTLPDG 241

  Fly   251 KWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIP-LSEIVDNVIQNCPIDVRRP 314
            |.::       :.|..|..         ||..|.|...|.|  .| :..|..:.|..|..|:|..
  Rat   242 KTVK-------LRKQVFRC---------PEALFSPYLVNVD--APGIDRICFSSIMKCDADLRNS 288

  Fly   315 LYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWF 379
            .::||:||||||.|....:||.:|:                .::.|....|||:....::.:||.
  Rat   289 FFSNIILSGGSTSFPGLDKRLIKDV----------------AKLAPANTTVQVVAPPERKISVWM 337

  Fly   380 GGSMLASTPEFYQVCHTKAAYEEYGPSI 407
            |||:|||...|..:..|.|.:||.||:|
  Rat   338 GGSILASLSAFQDMWITAAEFEEVGPNI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 129/417 (31%)
Actrt3NP_001102412.1 ACTIN 5..371 CDD:214592 129/414 (31%)
NBD_sugar-kinase_HSP70_actin 9..371 CDD:302596 128/410 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.