DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actrt1

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001013983.1 Gene:Actrt1 / 302796 RGDID:1359559 Length:376 Species:Rattus norvegicus


Alignment Length:417 Identity:136/417 - (32%)
Similarity:196/417 - (47%) Gaps:77/417 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKE----SARVGDTNTRRITKGIEDLDFFIGDEA 66
            ||.:.|.|:|..|:|.:|...|:.:|.|.:...:    |||   :|.:|         :|:|:||
  Rat    10 PAVIFDNGSGLCKVGISGEIVPRHVINSVVGHPKFNIPSAR---SNRKR---------YFVGEEA 62

  Fly    67 ---FDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAE 128
               :|  |..:.||:..|||..||.||:..:......|..:|.:....:|||.||..|.||.|.|
  Rat    63 QCMYD--GLYLHYPIERGLVTRWDDMEKLWKDLFEWELGVKPNEQPVFMTEPSLNPRETREKTTE 125

  Fly   129 IMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHI 193
            ||||.||||.||:...||.||.||        ..:||:|:|||||||..:|:.|||.:...|..:
  Rat   126 IMFEKFNVPALYLCNHAVGALCAS--------ACITGLVLDSGDGVTCTVPIYEGYSLPRAITKL 182

  Fly   194 PIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYI---------CPDIAKEFAKYDTEP 249
            .:|||:||..:..||..:....|...:......||||.|.:         |  ..:..::|....
  Rat   183 YVAGRDITEHLTRLLLAKGYTFPCILNKAVVDDIKEKLCTVSWGSKDSEKC--YQRSLSEYKLPD 245

  Fly   250 GKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRP 314
            |         ||:..:.....|       ||:.|.||... ...:.:|::|.|.|..|..|::..
  Rat   246 G---------NTIQMSDHLCQV-------PEVLFTPEHLG-IHDLGISKMVCNSIMKCDTDIQEN 293

  Fly   315 LYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLS-EGRIKPKPIDVQVITHHMQR-YAV 377
            |:..||||||:|:|.....||.:::           |.|: ||    .||.   ||....| |:.
  Rat   294 LFAEIVLSGGTTLFPGLQDRLLKEL-----------EVLAFEG----TPIK---ITASPDRCYSA 340

  Fly   378 WFGGSMLASTPEFYQVCHTKAAYEEYG 404
            |.|||::.|...|.|:..|...::|||
  Rat   341 WIGGSVMTSLTTFKQMWVTAEDFKEYG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 136/417 (33%)
Actrt1NP_001013983.1 ACTIN 9..376 CDD:214592 136/417 (33%)
NBD_sugar-kinase_HSP70_actin 11..376 CDD:302596 135/416 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.