DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actr10

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001009602.1 Gene:Actr10 / 299121 RGDID:1306515 Length:417 Species:Rattus norvegicus


Alignment Length:451 Identity:109/451 - (24%)
Similarity:187/451 - (41%) Gaps:109/451 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAF 67
            |...|.|||:|..::|.||||...|:.||||.|     .|.|      ::|.|:.:.:.|..|  
  Rat    11 GEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI-----KRAG------MSKPIKVVQYNINTE-- 62

  Fly    68 DATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132
                            |.:..::.|:....|::|...|.|...::.|..|.....||....::|:
  Rat    63 ----------------ELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFK 111

  Fly   133 TFNVPGLYIAVQAVLALAASWASRSAEERTL---TGIVVDSGDGVTHVIPVAEGYVIGSCIKHIP 194
            .|.||.:.:|...::||.           ||   :.:|:|.|...:.|:|:.||..:.:|...:|
  Rat   112 YFEVPSVLLAPSHLMALL-----------TLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALP 165

  Fly   195 IAGRNITSFIQSLLRER---------------EVGIPPEQSLETAKAIKEKHCYICPDIAKEFAK 244
            :.|:.:...:::.|.|:               .:|..||..||.   ||.:.|::.         
  Rat   166 LGGKALHKELETQLLEQCTVDTGAAKGQSLPSVMGSVPESVLED---IKVRTCFVS--------- 218

  Fly   245 YDTEPGKWIR----NFSGVNTVTKAPFNVD-----------VGYERFLGPEIFFHPEFSNPDFTI 294
             |.:.|..|:    |..|.|.....|.|||           :|..|....||.|  |..|.:.::
  Rat   219 -DLQRGLQIQAAKFNIDGNNERPSPPPNVDYPLDGEKILHVLGSIRDSVVEILF--EQDNEEKSV 280

  Fly   295 PLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVD-TRLRISENLSEGRI 358
             .:.|:|:::| ||:|.|:.|..|:|:.||::|...|..||..:|:..|: .:.:.:......||
  Rat   281 -ATLILDSLLQ-CPVDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKNFRI 343

  Fly   359 KPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAYEEY------GPSICR-HNP 412
            ...|.....:        .|.||::..:..:   :..:::..:||      .|..|. :||
  Rat   344 HTPPAKANCV--------AWLGGAVFGALQD---ILGSRSISKEYYNQTGRTPDWCSLNNP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 109/451 (24%)
Actr10NP_001009602.1 NBD_sugar-kinase_HSP70_actin 13..364 CDD:418402 102/415 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.