DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actr1a

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_006231532.1 Gene:Actr1a / 294010 RGDID:1307025 Length:396 Species:Rattus norvegicus


Alignment Length:424 Identity:150/424 - (35%)
Similarity:221/424 - (52%) Gaps:77/424 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA------- 66
            |||.|:|..|.||||::.|::..|:        .||.....|:..|..:.|.|||.:|       
  Rat    13 VIDNGSGVIKAGFAGDQIPKYCFPN--------YVGRPKHVRVMAGALEGDIFIGPKAEVIPSPT 69

  Fly    67 FDATG--------------YSIKYPVRHGLVEDWDLMERFLEQCVFK-YLRAEPEDHYFLLTEPP 116
            .:|:|              .||:||:.||:|:||:.|||..:....| .|:...|:|..||||.|
  Rat    70 EEASGLQRAYLSTTEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAP 134

  Fly   117 LNTPENREYTAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVA 181
            ||..:|||..||:.|||||||.|:|::||||:|.|:       .|| ||:|:||||||||.:|:.
  Rat   135 LNPRKNRERAAEVFFETFNVPALFISMQAVLSLYAT-------GRT-TGVVLDSGDGVTHAVPIY 191

  Fly   182 EGYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAK------ 240
            ||:.:...|..|.||||:::.|::..||:...........|..|||||:.||:..:..|      
  Rat   192 EGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLET 256

  Fly   241 EFAKYDTEPGKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQ 305
            |.|:|....|.                .:::|..||..||:.|.|:....: :..:.|::...||
  Rat   257 EKAQYYLPDGS----------------TIEIGPSRFRAPELLFRPDLIGEE-SEGIHEVLVFAIQ 304

  Fly   306 NCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITH 370
            ...:|:||.|::|||||||||:||.||.||..::|                ::.||.:.:::...
  Rat   305 KSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVK----------------KLAPKDVKIRISAP 353

  Fly   371 HMQRYAVWFGGSMLASTPEFYQVCHTKAAYEEYG 404
            ..:.|:.|.|||:|||...|.::..:|..|||.|
  Rat   354 QERLYSTWIGGSILASLDTFKKMWVSKKEYEEDG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 150/424 (35%)
Actr1aXP_006231532.1 NBD_sugar-kinase_HSP70_actin 5..396 CDD:418402 150/424 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.