DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and ACTL9

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_848620.3 Gene:ACTL9 / 284382 HGNCID:28494 Length:416 Species:Homo sapiens


Alignment Length:416 Identity:127/416 - (30%)
Similarity:203/416 - (48%) Gaps:55/416 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGRLP----ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFF 61
            :|.|||    |.|||:|||..|:||||...|.:.:.:.:        |....:..|.|...|..|
Human    41 VADRLPPKTGAVVIDMGTGTCKVGFAGQASPTYTVATIL--------GCQPKKPATSGQSGLQTF 97

  Fly    62 IGDEAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYT 126
            ||:.|......::..|:|.|:|.|||..|......:...||....||..|.::||.:...|||..
Human    98 IGEAARVLPELTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKL 162

  Fly   127 AEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIK 191
            .|:.||:...|.:|:|.|:||::.|        ...::|:|||:|.|||:.:||.:||.:....:
Human   163 VEVAFESLRSPAMYVASQSVLSVYA--------HGRVSGLVVDTGHGVTYTVPVFQGYNLLHATE 219

  Fly   192 HIPIAGRNITSFIQSLLREREVGIP-PEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRN 255
            .:.:||.|:|:|:..:|  .:.|:| .:|.|:..:.||..:||:..|..||.|:.:.|..:.::.
Human   220 RLDLAGNNLTAFLAEML--LQAGLPLGQQDLDLVENIKHHYCYVASDFQKEQARPEQEYKRTLKL 282

  Fly   256 FSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDF----TIPLSEIVDNVIQNCPIDVRRPLY 316
            ..| .|||       :|.|.|..||:.|:|    |:.    .:.||.:....::...:::|..|.
Human   283 PDG-RTVT-------LGKELFQCPELLFNP----PEVPGLSPVGLSTMAKQSLRKLSLEMRADLA 335

  Fly   317 NNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGG 381
            .|::|.|||::|..|..|.:.::.|::                |....|.|.....:.::||.||
Human   336 QNVLLCGGSSLFTGFEGRFRAELLRAL----------------PAETHVVVAAQPTRNFSVWIGG 384

  Fly   382 SMLASTPEFYQVCHTKAAYEEYGPSI 407
            |:|||...|......:..|||.||.|
Human   385 SILASLRAFQSCWVLREQYEEQGPYI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 127/415 (31%)
ACTL9NP_848620.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
NBD_sugar-kinase_HSP70_actin 49..416 CDD:302596 123/408 (30%)
ACTIN 49..415 CDD:214592 123/408 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.