DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and POTEH

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001129685.1 Gene:POTEH / 23784 HGNCID:133 Length:545 Species:Homo sapiens


Alignment Length:162 Identity:33/162 - (20%)
Similarity:61/162 - (37%) Gaps:54/162 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 IQSLLREREVGIPPEQ-SLETAK--AIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKA 265
            |.|||.|:.:.:..:. |.:||:  |:..:|..|| .:..::.:      |.|...|..|     
Human   357 IVSLLLEQNIDVSSQDLSGQTAREYAVSSRHNVIC-QLLSDYKE------KQILKVSSEN----- 409

  Fly   266 PFNVDVGYERFLGPEIFFHPEFSNPDFTIPL-----SEIVDNVIQNCPIDV-RRPLYNNIVLSGG 324
                                  |||:..:.|     |:.:.....:.|.:: :.|..|    .||
Human   410 ----------------------SNPEQDLKLTSEEESQRLKGSENSQPEEMSQEPEIN----KGG 448

  Fly   325 STMFKDFGRRLQRDIKRSVDTRLRISENLSEG 356
            .       |:::.::|:...|.:...|||:.|
Human   449 D-------RKVEEEMKKHGSTHMGFPENLTNG 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 33/162 (20%)
POTEHNP_001129685.1 Ank_4 180..230 CDD:290365
ANK 1 180..208
ANK 204..329 CDD:238125
ANK 2 209..238
ANK repeat 211..240 CDD:293786
Ank_2 214..306 CDD:289560
ANK repeat 242..273 CDD:293786
ANK 3 242..271
ANK 270..394 CDD:238125 12/37 (32%)
ANK repeat 275..306 CDD:293786
ANK 4 275..304
Ank_2 280..372 CDD:289560 5/14 (36%)
ANK repeat 308..339 CDD:293786
ANK 5 308..337
ANK repeat 341..372 CDD:293786 5/14 (36%)
ANK 6 341..370 5/12 (42%)
ANK 7 374..404 9/36 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..524 19/106 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.