DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and ACTRT2

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_536356.3 Gene:ACTRT2 / 140625 HGNCID:24026 Length:377 Species:Homo sapiens


Alignment Length:411 Identity:127/411 - (30%)
Similarity:200/411 - (48%) Gaps:58/411 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PACVIDVGTGYSKLGFAGNKEPQFIIPSAIA-IKESARVGDTNTRRITKGIEDLDFFIGDEA-FD 68
            ||.:.|.|:|:.|.|.:|...|:.::.|.:. :|..|...:.|.::         :|:|:|| :.
Human    10 PAVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKK---------YFVGEEALYK 65

  Fly    69 ATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFET 133
            .....:..|...||:..||.:||..:......|..:|.|...|.|||.||..||||..||:|||.
Human    66 QEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 130

  Fly   134 FNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGR 198
            |.||..|::.||||||.||        ..:||:||||||.||..:|:.|||.:...:..:.:|||
Human   131 FGVPAFYLSDQAVLALYAS--------ACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGR 187

  Fly   199 NITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVT 263
            :||..:..||.......|.:........||:|.||:..:..||.::   .|.:.:|.:       
Human   188 DITELLMQLLLASGHTFPCQLDKGLVDDIKKKLCYVALEPEKELSR---RPEEVLREY------- 242

  Fly   264 KAPFN--VDVGYERFLGPEIFFHPE---FSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSG 323
            |.|..  :.:|......||..|.|:   ..:|.    ||.:|.:.|..|..|:::.|:..|||||
Human   243 KLPDGNIISLGDPLHQAPEALFVPQQLGSQSPG----LSNMVSSSITKCDTDIQKILFGEIVLSG 303

  Fly   324 GSTMFKDFGRRLQRDIKR--SVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLAS 386
            |:|:|.....||.:::::  |.||.::|:          .|.|        :.::.|.|.|::.|
Human   304 GTTLFHGLDDRLLKELEQLASKDTPIKIT----------APPD--------RWFSTWIGASIVTS 350

  Fly   387 TPEFYQVCHTKAAYEEYGPSI 407
            ...|.|:..|.|.::|:|.|:
Human   351 LSSFKQMWVTAADFKEFGTSV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 127/411 (31%)
ACTRT2NP_536356.3 ACTIN 10..377 CDD:214592 127/411 (31%)
NBD_sugar-kinase_HSP70_actin 11..377 CDD:302596 126/410 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.